RAB8B Antibody

Images

 
Western Blot: RAB8B Antibody [NBP1-68974] - The repeat Western Blot of RAB8B showed endogenous RAB8B expressed in both species. This was confirmed with GFP-tagged mRAB8B corresponding to the GFP antibody. Image ...read more
Western Blot: RAB8B Antibody [NBP1-68974] - COLO205 cell lysate, antibody titration 1.0ug/ml. Gel concentration 12%.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB8B Antibody Summary

Immunogen
Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAB8B and was validated on Western blot.
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB8B Antibody

  • FLJ38125
  • RAB-8b protein
  • RAB8B, member RAS oncogene family
  • ras-related protein Rab-8B

Background

RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68974
Species: Hu
Applications: WB

Publications for RAB8B Antibody (NBP1-68974) (0)

There are no publications for RAB8B Antibody (NBP1-68974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8B Antibody (NBP1-68974) (0)

There are no reviews for RAB8B Antibody (NBP1-68974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8B Antibody (NBP1-68974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB8B Products

Bioinformatics Tool for RAB8B Antibody (NBP1-68974)

Discover related pathways, diseases and genes to RAB8B Antibody (NBP1-68974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8B Antibody (NBP1-68974)

Discover more about diseases related to RAB8B Antibody (NBP1-68974).
 

Pathways for RAB8B Antibody (NBP1-68974)

View related products by pathway.

PTMs for RAB8B Antibody (NBP1-68974)

Learn more about PTMs related to RAB8B Antibody (NBP1-68974).
 

Research Areas for RAB8B Antibody (NBP1-68974)

Find related products by research area.

Blogs on RAB8B

There are no specific blogs for RAB8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8B
Uniprot