QKI/Quaking Antibody

Images

 
Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebellum shows strong positivity in subsets of cells.
Western Blot: QKI/Quaking Antibody [NBP1-87178] - Analysis in human cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse cerebellum shows strong immunoreactivity in purkinje cells.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse pons shows positivity in selected cells in the sensory trigeminal nucleus.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse dentate gyrus shows positivity in the polymorph layer neurons.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse olfactory bulb shows selective immunoreactivity in the rostral migratory stream.
Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody [NBP1-87178] - Staining of mouse thalamus shows immunoreactivity in a subset of cells in the medial habenular nucleus.
Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: QKI/Quaking Antibody [NBP1-87178] - Staining of human cerebellum shows nuclear immunoreactivity in a subset of cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QKI/Quaking Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QKI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
QKI/Quaking Protein (NBP1-87178PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QKI/Quaking Antibody

  • DKFZp586I0923
  • HKQ
  • homolog of mouse quaking QKI (KH domain RNA binding protein)
  • Hqk
  • hqkI
  • protein quaking
  • QK
  • QK1
  • QK3
  • quaking homolog, KH domain RNA binding (mouse)
  • RNA binding protein HQK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP2-14001
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
AF1555
Species: Hu
Applications: WB
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for QKI/Quaking Antibody (NBP1-87178) (0)

There are no publications for QKI/Quaking Antibody (NBP1-87178).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QKI/Quaking Antibody (NBP1-87178) (0)

There are no reviews for QKI/Quaking Antibody (NBP1-87178). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for QKI/Quaking Antibody (NBP1-87178) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QKI/Quaking Products

Bioinformatics Tool for QKI/Quaking Antibody (NBP1-87178)

Discover related pathways, diseases and genes to QKI/Quaking Antibody (NBP1-87178). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QKI/Quaking Antibody (NBP1-87178)

Discover more about diseases related to QKI/Quaking Antibody (NBP1-87178).
 

Pathways for QKI/Quaking Antibody (NBP1-87178)

View related products by pathway.

PTMs for QKI/Quaking Antibody (NBP1-87178)

Learn more about PTMs related to QKI/Quaking Antibody (NBP1-87178).
 

Research Areas for QKI/Quaking Antibody (NBP1-87178)

Find related products by research area.

Blogs on QKI/Quaking

There are no specific blogs for QKI/Quaking, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QKI/Quaking Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QKI