Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis in human heart muscle and pancreas tissues. Corresponding Pyruvate Dehydrogenase E1 beta subunit RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-Pyruvate Dehydrogenase E1 beta subunit antibody NBP2-38327 (A) shows similar protein distribution across tissues to independent antibody NBP1-87421 (B).

Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis using Anti-PDHB antibody NBP2-38327 (A) shows similar pattern to independent antibody NBP1-87421 (B).

Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in distal tubules.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free (NBP2-38327) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDHB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.
• Control Peptide:

  Pyruvate Dehydrogenase E1 beta subunit Protein (NBP2-38327PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free

• DKFZp564K0164
• mitochondrial
• pyruvate dehydrogenase (lipoamide) beta
• pyruvate dehydrogenase, E1 beta polypeptide

Background

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDHB
• Uniprot:
  • P11177(Human)