Novus Biologicals products are now on bio-techne.com

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody

Images

 
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human pancreas shows very weak granular cytoplasmic positivity in islets of Langerhans.
Orthogonal Strategies: Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same ...read more
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human adrenal gland shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in distal tubules.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Independent Antibodies: Analysis using NBP1-87308 (A) shows similar pattern to independent antibody NBP1-82432 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody

  • [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
  • EC 3.1.3
  • EC 3.1.3.43
  • MGC119646
  • PDH
  • PDP 1
  • PDP1
  • PDPC 1
  • PDPC
  • PDPFLJ32517
  • PPM2C
  • PPM2CFLJ56179
  • Protein phosphatase 2C
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit
  • pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase
  • Pyruvate dehydrogenase phosphatase catalytic subunit 1
  • Pyruvate Dehydrogenase Phosphatase
  • pyruvate dehyrogenase phosphatase catalytic subunit 1

Background

Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-13878
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-07047
Species: Hu, Mu
Applications: ICC/IF, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-87307
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-93479
Species: Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IP, KO, WB
NBP2-34065
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82912
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDP1