Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody

Images

 
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human liver shows strong granular positivity in hepatocytes.
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Protein (NBP1-87308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody

  • [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
  • EC 3.1.3
  • EC 3.1.3.43
  • MGC119646
  • PDH
  • PDP 1
  • PDP1
  • PDPC 1
  • PDPC
  • PDPFLJ32517
  • PPM2C
  • PPM2CFLJ56179
  • Protein phosphatase 2C
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit
  • pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase
  • Pyruvate dehydrogenase phosphatase catalytic subunit 1
  • Pyruvate Dehydrogenase Phosphatase
  • pyruvate dehyrogenase phosphatase catalytic subunit 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-93479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82912
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87308
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Products

Bioinformatics Tool for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308)

Discover related pathways, diseases and genes to Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308)

Discover more about diseases related to Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308).
 

Pathways for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308)

View related products by pathway.

PTMs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308)

Learn more about PTMs related to Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody (NBP1-87308).

Blogs on Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C

There are no specific blogs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDP1
Entrez