Synaptotagmin 4 Antibody

Images

 
Western Blot: Synaptotagmin 4 Antibody [NBP2-13408] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Synaptotagmin 4 Antibody [NBP2-13408] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane & vesicles.
Immunohistochemistry-Paraffin: Synaptotagmin 4 Antibody [NBP2-13408] - Staining of human smooth muscle shows moderate cytoplasmic positivity in muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptotagmin 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHL DLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTS LTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synaptotagmin 4 Protein (NBP2-13408PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptotagmin 4 Antibody

  • HsT1192
  • KIAA1342sytIV
  • synaptotagmin 4
  • synaptotagmin IVsynaptotagmin-4
  • SytIV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-19320
Species: Mu, Rt, Fi, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-13568
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81628
Species: Hu
Applications: WB, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-81588
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Synaptotagmin 4 Antibody (NBP2-13408) (0)

There are no publications for Synaptotagmin 4 Antibody (NBP2-13408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 4 Antibody (NBP2-13408) (0)

There are no reviews for Synaptotagmin 4 Antibody (NBP2-13408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptotagmin 4 Antibody (NBP2-13408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptotagmin 4 Products

Bioinformatics Tool for Synaptotagmin 4 Antibody (NBP2-13408)

Discover related pathways, diseases and genes to Synaptotagmin 4 Antibody (NBP2-13408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 4 Antibody (NBP2-13408)

Discover more about diseases related to Synaptotagmin 4 Antibody (NBP2-13408).
 

Pathways for Synaptotagmin 4 Antibody (NBP2-13408)

View related products by pathway.

PTMs for Synaptotagmin 4 Antibody (NBP2-13408)

Learn more about PTMs related to Synaptotagmin 4 Antibody (NBP2-13408).
 

Research Areas for Synaptotagmin 4 Antibody (NBP2-13408)

Find related products by research area.

Blogs on Synaptotagmin 4

There are no specific blogs for Synaptotagmin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptotagmin 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT4