PNKD Antibody

Images

 
Genetic Strategies: Western Blot: PNKD Antibody [NBP1-88347] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PNKD antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: PNKD Antibody [NBP1-88347] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PNKD Antibody [NBP1-88347] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

PNKD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNKD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25617893). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNKD Protein (NBP1-88347PEP)
Publications
Read Publication using
NBP1-88347 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25617893).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNKD Antibody

  • BRP17FKSG19
  • DKFZp564N1362
  • DYT8paroxysmal nonkinesiogenic dyskinesia
  • FPD1brain protein 17
  • KIAA1184Myofibrillogenesis regulator 1
  • KIPP1184probable hydrolase PNKD
  • MGC31943
  • MR1Paroxysmal nonkinesiogenic dyskinesia protein
  • MR-1Trans-activated by hepatitis C virus core protein 2
  • paroxysmal nonkinesigenic dyskinesia
  • PDCEC 3.-
  • TAHCCP2PKND1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCDL40
Species: Hu
Applications: ELISA
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-34065
Species: Hu
Applications: IHC, IHC-P, WB
AF1436
Species: Mu
Applications: WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
MAB6322
Species: Hu
Applications: Neut, WB
NBP2-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
336-MD
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-88347
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for PNKD Antibody (NBP1-88347)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PNKD Antibody (NBP1-88347) (0)

There are no reviews for PNKD Antibody (NBP1-88347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNKD Antibody (NBP1-88347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PNKD Products

Array NBP1-88347

Bioinformatics Tool for PNKD Antibody (NBP1-88347)

Discover related pathways, diseases and genes to PNKD Antibody (NBP1-88347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNKD Antibody (NBP1-88347)

Discover more about diseases related to PNKD Antibody (NBP1-88347).
 

Pathways for PNKD Antibody (NBP1-88347)

View related products by pathway.

PTMs for PNKD Antibody (NBP1-88347)

Learn more about PTMs related to PNKD Antibody (NBP1-88347).

Blogs on PNKD

There are no specific blogs for PNKD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNKD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNKD