Pyridoxal Kinase/PDXK Antibody

Images

 
Independent Antibodies: Western Blot: Pyridoxal Kinase/PDXK Antibody [NBP1-88283] - Analysis using Anti-PDXK antibody NBP1-88283 (A) shows similar pattern to independent antibody NBP1-88284 (B).
Immunocytochemistry/ Immunofluorescence: Pyridoxal Kinase/PDXK Antibody [NBP1-88283] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pyridoxal Kinase/PDXK Antibody [NBP1-88283] - Staining of human gall bladder shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: Pyridoxal Kinase/PDXK Antibody [NBP1-88283] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Pyridoxal Kinase/PDXK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDXK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pyridoxal Kinase/PDXK Protein (NBP1-88283PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pyridoxal Kinase/PDXK Antibody

  • C21orf124
  • C21orf97
  • chromosome 21 open reading frame 124
  • DKFZp566A071
  • EC 2.7.1.35
  • FLJ21324
  • FLJ37311
  • HEL-S-1a
  • MGC15873
  • MGC31754
  • MGC52346
  • PDXK
  • PKH
  • PKHchromosome 21 open reading frame 97
  • PNK
  • PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940
  • PRED79
  • pyridoxal (pyridoxine, vitamin B6) kinase
  • Pyridoxal Kinase
  • pyridoxamine kinase
  • Pyridoxine kinase
  • Vitamin B6 Kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB6734
Species: Hu
Applications: IHC
NBP1-87302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP2-46376
Species: Hu
Applications: IHC, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP3-10064
Species: Hu
Applications: WB
NBP1-88283
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Pyridoxal Kinase/PDXK Antibody (NBP1-88283) (0)

There are no publications for Pyridoxal Kinase/PDXK Antibody (NBP1-88283).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyridoxal Kinase/PDXK Antibody (NBP1-88283) (0)

There are no reviews for Pyridoxal Kinase/PDXK Antibody (NBP1-88283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pyridoxal Kinase/PDXK Antibody (NBP1-88283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pyridoxal Kinase/PDXK Products

Bioinformatics Tool for Pyridoxal Kinase/PDXK Antibody (NBP1-88283)

Discover related pathways, diseases and genes to Pyridoxal Kinase/PDXK Antibody (NBP1-88283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pyridoxal Kinase/PDXK Antibody (NBP1-88283)

Discover more about diseases related to Pyridoxal Kinase/PDXK Antibody (NBP1-88283).
 

Pathways for Pyridoxal Kinase/PDXK Antibody (NBP1-88283)

View related products by pathway.

PTMs for Pyridoxal Kinase/PDXK Antibody (NBP1-88283)

Learn more about PTMs related to Pyridoxal Kinase/PDXK Antibody (NBP1-88283).

Blogs on Pyridoxal Kinase/PDXK

There are no specific blogs for Pyridoxal Kinase/PDXK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pyridoxal Kinase/PDXK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDXK