PURL Antibody

Images

 
Western Blot: PURL Antibody [NBP1-70692] - 293T Whole Cell lysates, Antibody Dilution: 0.05 ug/ml.
Western Blot: PURL Antibody [NBP1-70692] - 1. Human Skin Fibroblasts (100ug) 2. HEK273 cells (20ug) 3. HeLa skin cells(20ug) at 1:2,000.
Western Blot: PURL Antibody [NBP1-70692] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PURL Antibody Summary

Immunogen
Synthetic peptides corresponding to PFAS(phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)) The peptide sequence was selected from the N terminal of PFAS. Peptide sequence ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PFAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PFAS and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PURL Antibody

  • FGAM synthase
  • FGAMS
  • FGAR amidotransferase
  • formylglycinamide ribotide synthetase
  • KIAA0361
  • phosphoribosylformylglycinamidine synthase
  • PURL

Background

Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis. Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002618-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-70691
Species: Hu
Applications: WB
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
AF3014
Species: Hu
Applications: WB, IHC, Block
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for PURL Antibody (NBP1-70692) (0)

There are no publications for PURL Antibody (NBP1-70692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PURL Antibody (NBP1-70692) (0)

There are no reviews for PURL Antibody (NBP1-70692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PURL Antibody (NBP1-70692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PURL Products

Bioinformatics Tool for PURL Antibody (NBP1-70692)

Discover related pathways, diseases and genes to PURL Antibody (NBP1-70692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PURL Antibody (NBP1-70692)

Discover more about diseases related to PURL Antibody (NBP1-70692).
 

Pathways for PURL Antibody (NBP1-70692)

View related products by pathway.

PTMs for PURL Antibody (NBP1-70692)

Learn more about PTMs related to PURL Antibody (NBP1-70692).

Blogs on PURL

There are no specific blogs for PURL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PURL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFAS