PURB Antibody

Images

 
Western Blot: PURB Antibody [NBP1-70691] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PURB Antibody Summary

Immunogen
Synthetic peptides corresponding to PURB(purine-rich element binding protein B) The peptide sequence was selected from the N terminal of PURB. Peptide sequence MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PURB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PURB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PURB Antibody

  • MGC126784
  • PURBETA
  • purine-rich element binding protein B

Background

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of euka

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005813-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-70691
Species: Hu
Applications: WB

Publications for PURB Antibody (NBP1-70691) (0)

There are no publications for PURB Antibody (NBP1-70691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PURB Antibody (NBP1-70691) (0)

There are no reviews for PURB Antibody (NBP1-70691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PURB Antibody (NBP1-70691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PURB Products

PURB NBP1-70691

Bioinformatics Tool for PURB Antibody (NBP1-70691)

Discover related pathways, diseases and genes to PURB Antibody (NBP1-70691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PURB Antibody (NBP1-70691)

Discover more about diseases related to PURB Antibody (NBP1-70691).
 

Pathways for PURB Antibody (NBP1-70691)

View related products by pathway.

PTMs for PURB Antibody (NBP1-70691)

Learn more about PTMs related to PURB Antibody (NBP1-70691).

Blogs on PURB

There are no specific blogs for PURB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PURB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PURB