PURG Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PURG Antibody [NBP2-13830] - Staining of human cell line SH-SY5Y shows localization to nucleus, nucleoli & plasma membrane.
Immunohistochemistry-Paraffin: PURG Antibody [NBP2-13830] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PURG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PURG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PURG Protein (NBP2-13830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PURG Antibody

  • MGC119274
  • PURG-A
  • Pur-gamma
  • PURG-B
  • purine-rich element binding protein G
  • purine-rich element-binding protein gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-70691
Species: Hu
Applications: WB
AF6486
Species: Hu
Applications: WB, Simple Western
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00005813-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13830
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PURG Antibody (NBP2-13830) (0)

There are no publications for PURG Antibody (NBP2-13830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PURG Antibody (NBP2-13830) (0)

There are no reviews for PURG Antibody (NBP2-13830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PURG Antibody (NBP2-13830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PURG Products

Bioinformatics Tool for PURG Antibody (NBP2-13830)

Discover related pathways, diseases and genes to PURG Antibody (NBP2-13830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PURG Antibody (NBP2-13830)

Discover more about diseases related to PURG Antibody (NBP2-13830).
 

Pathways for PURG Antibody (NBP2-13830)

View related products by pathway.

Blogs on PURG

There are no specific blogs for PURG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PURG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PURG