PUM2 Antibody - BSA Free

Western Blot: PUM2 Antibody [NBP2-56823] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: PUM2 Antibody [NBP2-56823] - Staining of human cell line A-431 shows localization to nuclear membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PUM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PUM2 Antibody - BSA Free (NBP2-56823) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PUM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PUM2 Recombinant Protein Antigen (NBP2-56823PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PUM2 Antibody - BSA Free

• FLJ36528
• KIAA0235PUMH2PUML2
• MGC138251
• MGC138253
• PUM2
• PUMH2
• pumilio (Drosphila) homolog 2
• pumilio homolog 2 (Drosophila)
• pumilio homolog 2
• Pumilio-2
• PUML2

Background

Pumilio 2 is a component of conserved cellular machinery required for germ cell development, Pum2 is a human homolog of Pumilio, which helps maintain germ line stem cells in Drosophila and C. elegans. Pum2 forms a stable complex with DAZ through the same functional domain required for RNA binding and protein-protein interactions. Pum2 is expressed predominantly in human embryonic stem cells and germ cells and colocalizes with DAZ and DAZL in germ cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PUM2