MOCOS Antibody - BSA Free

Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: MOCOS Antibody [NBP2-14243] - Staining of human cell line RT4 shows localization to cytosol & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells.

Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specific band for MOCOS in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of corresponding Simple Western lane view. MOCOS antibody was used at 1:30 dilution on RT-4 lysate(s).

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MOCOS Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOCOS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:30, apparent MW was 105 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  MOCOS Protein (NBP2-14243PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26239292). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MOCOS Antibody - BSA Free

• FLJ20733
• HMCS
• MCSEC 4.4
• molybdenum cofactor sulfurase
• MOSMoCo sulfurase

Background

Sulfurates the molybdenum cofactor. Sulfation of molybdenum is essential for xanthine dehydrogenase (XDH) and aldehyde oxidase (ADO) enzymes in which molybdenum cofactor is liganded by 1 oxygen and 1 sulfur atom in active form

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MOCOS Antibody (NBP2-14243)(2)

Publications using NBP2-14243

• Delphine Sedda, Claire Mackowiak, Julie Pailloux, Elodie Culerier, Ana Dudas, Pauline Rontani, Nicolas Erard, Antoine Lefevre, Sylvie Mavel, Patrick Emond, Frederic Foucher, Marc Le Bert, Valerie F.J. Quesniaux, Michael J. Mihatsch, Bernhard Ryffel, Madeleine Erard-Garcia Deletion of Mocos Induces Xanthinuria with Obstructive Nephropathy and Major Metabolic Disorders in Mice Kidney360 2021-09-17 [PMID: 35372998]
• Feron F, Gepner B, Lacassagne E et al. Olfactory stem cells reveal MOCOS as a new player in autism spectrum disorders Mol Psychiatry. 2015-08-04 [PMID: 26239292] (ICC/IF, WB, IF/IHC, Mouse, Human)

Bioinformatics

• Gene Symbol: MOCOS