Home » MOCOS » MOCOS Research Products » MOCOS Antibody

MOCOS Antibody

 (1 Publication)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MOCOS Antibody [NBP2-14243] - Staining of human cell line RT4 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells.
Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specific band for MOCOS in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of corresponding Simple Western lane view. MOCOS antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MOCOS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIK QSSNSQRNAKKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOCOS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use ICC/IF reported in scientific literature (PMID 26239292).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
MOCOS Protein (NBP2-14243PEP)
Publications
Read Publication using
NBP2-14243 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26239292). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOCOS Antibody

  • FLJ20733
  • hMCS
  • MCSEC 4.4
  • molybdenum cofactor sulfurase
  • MOSMoCo sulfurase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
Mesothelin
Antibody (MSLN/2131)
NBP2-79724
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Lung Mesothelioma stained with Mesothelin Antibody (MSLN/2131).
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Endometrial Carcinoma stained with Mesothelin Antibody (MSLN/2131).
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Tonsil stained with Mesothelin Antibody (MSLN/2131).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(36 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues . Corresponding CDK1 RNA-seq data are presented for the same tissues.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in human cell line A-431.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Fos Antibody
NBP1-89065
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NBP1-89065] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ZHX2 Antibody
NBP1-82956
Immunocytochemistry/Immunofluorescence: ZHX2 Antibody [NBP1-82956] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ZHX2 antibody NBP1-82956 (A) shows similar protein distribution across tissues to independent antibody NBP1-82955 (B).
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human lymph node.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA/CF
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(702 Publications)
Species: Hu
Applications: BA
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(1 Publication)
Species: Hu
Applications: BA
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Analysis in human lymph node and liver tissues. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Xanthine Oxidase
Antibody (0M8E7)
NBP3-16735
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry of paraffin-embedded rat kidney using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry of paraffin-embedded human oophoroma using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (0M8E7) [NBP3-16735] - Immunohistochemistry of paraffin-embedded mouse brain using Xanthine Oxidase (XDH) Rabbit mAb (NBP3-16735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MEK1 Antibody
(SZ22-01)
NBP2-67358
Flow Cytometry: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of HeLa cells with MEK1 antibody at 1:50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in HeLa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in human cell line A-431.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of human skin shows moderate positivity in basement membrane of epidermis.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for MOCOS Antibody (NBP2-14243)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MOCOS Antibody (NBP2-14243) (0)

There are no reviews for MOCOS Antibody (NBP2-14243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MOCOS Antibody (NBP2-14243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOCOS Products

Bioinformatics Tool for MOCOS Antibody (NBP2-14243)

Discover related pathways, diseases and genes to MOCOS Antibody (NBP2-14243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCOS Antibody (NBP2-14243)

Discover more about diseases related to MOCOS Antibody (NBP2-14243).
 

Pathways for MOCOS Antibody (NBP2-14243)

View related products by pathway.

PTMs for MOCOS Antibody (NBP2-14243)

Learn more about PTMs related to MOCOS Antibody (NBP2-14243).

Blogs on MOCOS

There are no specific blogs for MOCOS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOCOS Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MOCOS