Home » MOCOS » MOCOS Antibodies » MOCOS Antibody

MOCOS Antibody

 (1 Publication)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MOCOS Antibody [NBP2-14243] - Staining of human cell line RT4 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells.
Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specific band for MOCOS in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of corresponding Simple Western lane view. MOCOS antibody was used at 1:30 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MOCOS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIK QSSNSQRNAKKK
Specificity
Specificity of human MOCOS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOCOS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use ICC/IF reported in scientific literature (PMID 26239292).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Publications
Read Publication using
NBP2-14243 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26239292). Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOCOS Antibody

  • FLJ20733
  • HMCS
  • MCSEC 4.4
  • molybdenum cofactor sulfurase
  • MOSMoCo sulfurase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
Mesothelin
Antibody (MB-G10)
NB110-85538
Western Blot: Mesothelin Antibody (MB-G10) [NB110-85538] - Detection of mesothelin-Fc at 100 ng (lane 1), 25 ng (lane 2), 6 ng (lane 3), 2 ng (lane 4) and 0.4 ng (lane 5). Lane 6 contains 50 ng of CDC25-Fc. Proteins were separated on 4-20% gradient gel by SDS-PAGE followed by transfer to PVDF membrane. Primary antibody was used at 1 g/ml followed by reaction with ALP goat anti-mouse IgG and BCI:5840-6.
Immunohistochemistry-Paraffin: Mesothelin Antibody (MB-G10) [NB110-85538] - Human tissue sections treated by antigen retrieval methods. Primary antibodies were used to label these sections as follows: C, MAb MB; and D, MAb MN. Reprinted with permission fromClin.Cancer Res. 11(16):5840-6.
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SGSM3 Antibody
NBP2-13304
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(45 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
c-Fos Antibody
NB110-75039
Western Blot: c-Fos Antibody [NB110-75039] - Analysis on marmoset brain lysate prepared in Ripa buffer containing 1% Triton-X100; 1% SDS and 1% SDC. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution 1:2000incubated at 4C overnight.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NB110-75039] - Rat trigeminal using Rabbit antibody to cFos: whole serum at a 1:500 dilution.
Immunohistochemistry-Paraffin: c-Fos Antibody [NB110-75039] - IHC on rat brain (paraffin section) using Rabbit antibody to cFos (c-fos): whole serum at 1: 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ZHX2 Antibody
NBP1-82956
Western Blot: ZHX2 Antibody [NBP1-82956] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-651
Immunocytochemistry/Immunofluorescence: ZHX2 Antibody [NBP1-82956] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZHX2 Antibody [NBP1-82956] - Staining of human cerebral cortex.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(26 Reviews)
(631 Publications)
Species: Hu
GM-CSF
7954-GM/CF
GM-CSF
(1 Publication)
Species: Hu
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Xanthine Oxidase
Antibody (JG38-40)
NBP2-75717
Western Blot: Xanthine Oxidase Antibody (JG38-40) [NBP2-75717] - Analysis of Xanthine Oxidase on human kidney tissue lysate using anti-Xanthine Oxidase antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (JG38-40) [NBP2-75717] - Analysis of paraffin-embedded rat liver tissue using anti-Xanthine Oxidase antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody (JG38-40) [NBP2-75717] - Analysis of paraffin-embedded human liver tissue using anti-Xanthine Oxidase antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MEK1 Antibody
(SZ22-01)
NBP2-67358
Western Blot: MEK1 Antibody (SZ22-01) [NBP2-67358] - Whole cell lysates (30 ug per lane) from three different hematological cancer cell lines. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of paraffin-embedded mouse uterus tissue using anti-MEK1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of A-431 cells using the Anti-LAMC2 monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for MOCOS Antibody (NBP2-14243)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MOCOS Antibody (NBP2-14243) (0)

There are no reviews for MOCOS Antibody (NBP2-14243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MOCOS Antibody (NBP2-14243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MOCOS Products

Bioinformatics Tool for MOCOS Antibody (NBP2-14243)

Discover related pathways, diseases and genes to MOCOS Antibody (NBP2-14243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCOS Antibody (NBP2-14243)

Discover more about diseases related to MOCOS Antibody (NBP2-14243).
 

Pathways for MOCOS Antibody (NBP2-14243)

View related products by pathway.

PTMs for MOCOS Antibody (NBP2-14243)

Learn more about PTMs related to MOCOS Antibody (NBP2-14243).

Blogs on MOCOS

There are no specific blogs for MOCOS, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOCOS Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MOCOS
Novus 100% Guarantee