PUF60 Antibody

Images

 
Western Blot: PUF60 Antibody [NBP1-57501] - Antibody Titration: 0.2-1 ug/ml Positive control: HelaPUF60 is supported by BioGPS gene expression data to be expressed in HeLa.
Immunohistochemistry: PUF60 Antibody [NBP1-57501]
Western Blot: PUF60 Antibody [NBP1-57501] - Transfected 293T Cell Lysate 5ug/ml Gel Concentration 12%
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP1-57501] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PUF60 Antibody Summary

Immunogen
Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUF60
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PUF60 and was validated on Western Blot and immunohistochemistry -paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PUF60 Antibody

  • FBP interacting repressor
  • FBP-interacting repressor
  • FIRpoly-U binding splicing factor PUF60
  • FLJ31379
  • FUSE-binding protein-interacting repressor
  • poly(U)-binding-splicing factor PUF60
  • poly-U binding splicing factor 60KDa
  • Ro ribonucleoprotein binding protein 1
  • Ro ribonucleoprotein-binding protein 1
  • Ro-binding protein 1
  • roBP1
  • RoBPI
  • siah binding protein 1,60 kDa poly(U)-binding-splicing factor
  • Siah-binding protein 1
  • siah-BP1
  • SIAHBP1pyrimidine tract binding splicing factor

Background

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-83918
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30407
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-79962
Species: Hu, Mu, Rt, Po, Bv, Ca, Gt, Mk, Ze
Applications: WB, IHC
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, KO, ELISA(Sta)
AF5697
Species: Hu
Applications: WB, ICC
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88617
Species: Hu
Applications: IHC, IHC-P
NBP1-54903
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PUF60 Antibody (NBP1-57501) (0)

There are no publications for PUF60 Antibody (NBP1-57501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUF60 Antibody (NBP1-57501) (0)

There are no reviews for PUF60 Antibody (NBP1-57501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUF60 Antibody (NBP1-57501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PUF60 Products

Bioinformatics Tool for PUF60 Antibody (NBP1-57501)

Discover related pathways, diseases and genes to PUF60 Antibody (NBP1-57501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUF60 Antibody (NBP1-57501)

Discover more about diseases related to PUF60 Antibody (NBP1-57501).
 

Pathways for PUF60 Antibody (NBP1-57501)

View related products by pathway.

Blogs on PUF60

There are no specific blogs for PUF60, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUF60 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PUF60
Uniprot