FARP2 Antibody

Images

 
Western Blot: FARP2 Antibody [NBP1-84680] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: FARP2 Antibody [NBP1-84680] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FARP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FARP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FARP2 Protein (NBP1-84680PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FARP2 Antibody

  • FERM, RhoGEF and pleckstrin domain protein 2
  • FGD1-related Cdc42-GEF
  • FIRFERM domain including RhoGEF
  • FRG
  • KIAA0793PH domain-containing family C member 3
  • Pleckstrin homology domain-containing family C member 3
  • PLEKHC3FERM, RhoGEF and pleckstrin domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-43835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88617
Species: Hu
Applications: IHC, IHC-P
NBP1-54903
Species: Hu
Applications: WB
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-43654
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FARP2 Antibody (NBP1-84680) (0)

There are no publications for FARP2 Antibody (NBP1-84680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FARP2 Antibody (NBP1-84680) (0)

There are no reviews for FARP2 Antibody (NBP1-84680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FARP2 Antibody (NBP1-84680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FARP2 Products

Bioinformatics Tool for FARP2 Antibody (NBP1-84680)

Discover related pathways, diseases and genes to FARP2 Antibody (NBP1-84680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FARP2 Antibody (NBP1-84680)

Discover more about diseases related to FARP2 Antibody (NBP1-84680).
 

Pathways for FARP2 Antibody (NBP1-84680)

View related products by pathway.

Blogs on FARP2

There are no specific blogs for FARP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FARP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FARP2