RAB14 Antibody

Images

 
Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: RAB14 Antibody [NBP1-84720] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 28294115). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control
RAB14 Antibody
Control Peptide
RAB14 Protein (NBP1-84720PEP)
Publications
Read Publication using
NBP1-84720 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB14 Antibody

  • bA165P4.3 (member RAS oncogene family)
  • F protein-binding protein 1
  • FBP
  • RAB-14
  • RAB14, member RAS oncogene family
  • ras-related protein Rab-14
  • small GTP binding protein RAB14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB3428
Species: Hu
Applications: IHC, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16542
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for RAB14 Antibody (NBP1-84720)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RAB14 Antibody (NBP1-84720) (0)

There are no reviews for RAB14 Antibody (NBP1-84720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB14 Antibody (NBP1-84720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional RAB14 Products

Bioinformatics Tool for RAB14 Antibody (NBP1-84720)

Discover related pathways, diseases and genes to RAB14 Antibody (NBP1-84720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB14 Antibody (NBP1-84720)

Discover more about diseases related to RAB14 Antibody (NBP1-84720).
 

Pathways for RAB14 Antibody (NBP1-84720)

View related products by pathway.

PTMs for RAB14 Antibody (NBP1-84720)

Learn more about PTMs related to RAB14 Antibody (NBP1-84720).
 

Research Areas for RAB14 Antibody (NBP1-84720)

Find related products by research area.

Blogs on RAB14

There are no specific blogs for RAB14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB14