RAB14 Antibody - BSA Free

Western blot shows lysates of DMS 53 parental cell line and RAB14 knockdown DMS 53 cell line (KD). Nitrocellulose membrane was probed with RAB14 Antibody (Catalog # NBP1-84720) followed by HRP-conjugated secondary antibody. A specific band was detected for RAB14 at approximately 23.8 kDa (as indicated) in the parental DMS 53 cell line but is significantly reduced in knockdown DMS 53 cell line. Primary antibody dilution used: 1/1000. The Ponceau stained transfer of the blot is shown. This experiment was conducted under reducing conditions. Image, protocol, and testing courtesy of YCharOS Inc. See ycharos.com for additional details.

Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-84720] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Analysis in human cell line RH-30.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAB14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAB14 Antibody - BSA Free (NBP1-84720) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RAB14 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  RAB14 Antibody - BSA Free

• Control Peptide:

  RAB14 Protein (NBP1-84720PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAB14 Antibody - BSA Free

• bA165P4.3 (member RAS oncogene family)
• F protein-binding protein 1
• FBP
• RAB-14
• RAB14, member RAS oncogene family
• ras-related protein Rab-14
• small GTP binding protein RAB14

Background

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 (PubMed 15004230)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB14 Antibody (NBP1-84720)(1)

Publication using NBP1-84720

• Gundry C, Marco S, Rainero E et al. Phosphorylation of Rab-coupling protein by LMTK3 controls Rab14-dependent EphA2 trafficking to promote cell:cell repulsion. Nat Commun. 2017-03-15 [PMID: 28294115] (WB, Human)

Bioinformatics

• Gene Symbol: RAB14