PTPRK Antibody

Immunocytochemistry/Immunofluorescence: PTPRK Antibody [NBP2-30977] - Staining of human cell line SiHa shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human prostate shows moderate positivity in apical membranes in glandular cells.

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human cerebral cortex shows moderate positivity in a subset of neural fibers.

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human endometrium shows moderate positivity in apical membranes in glandular cells.

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PTPRK Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PTPRK Protein (NBP2-30977PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTPRK Antibody

• DKFZp686C2268
• DKFZp779N1045
• EC 3.1.3.48
• protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappa
• protein tyrosine phosphatase, receptor type, K
• Protein-tyrosine phosphatase kappa
• protein-tyrosine phosphatase, receptor type, kappa
• PTPK
• receptor type, K (R-PTP-KAPPA
• receptor-type tyrosine-protein phosphatase kappa

Background

PTP kappa (PTPRK)is a member of the protein tyrosine phosphatase (PTP) family. The family comprises at least 37 proteins, characterized by a catalytic phosphatase domain of approximately 240 amino acids, and includes both transmembrane and cytosolic enzymes. PTP kappa is c-transmembrane PTP. The PTPs have high substrate specificity for phosphotyrosyl proteins and, at the primary sequence level, share little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. PTP kappa is involved in the regulation of processes involving cell contact and adhesion, tumour invasion and metastasis. Regulation of processes involving cell contact and adhesion such as growth control. tumor invasion. and metastasis. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTP-kappa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRK
• Uniprot:
  • Q15262(Human)