PTPRK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTPRK Antibody [NBP2-30977] - Staining of human cell line SiHa shows localization to plasma membrane & cell junctions.
Immunohistochemistry: PTPRK Antibody [NBP2-30977] - Staining of human stomach, upper shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPRK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPRK Protein (NBP2-30977PEP)

Reactivity Notes

Mouse (80%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPRK Antibody

  • DKFZp686C2268
  • DKFZp779N1045
  • EC 3.1.3.48
  • protein tyrosine phosphatase kappa, protein tyrosine phosphatase kappa
  • protein tyrosine phosphatase, receptor type, K
  • Protein-tyrosine phosphatase kappa
  • protein-tyrosine phosphatase, receptor type, kappa
  • PTPK
  • receptor type, K (R-PTP-KAPPA
  • receptor-type tyrosine-protein phosphatase kappa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF3697
Species: Hu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTPRK Antibody (NBP2-30977) (0)

There are no publications for PTPRK Antibody (NBP2-30977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRK Antibody (NBP2-30977) (0)

There are no reviews for PTPRK Antibody (NBP2-30977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTPRK Antibody (NBP2-30977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPRK Products

Bioinformatics Tool for PTPRK Antibody (NBP2-30977)

Discover related pathways, diseases and genes to PTPRK Antibody (NBP2-30977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPRK Antibody (NBP2-30977)

Discover more about diseases related to PTPRK Antibody (NBP2-30977).
 

Pathways for PTPRK Antibody (NBP2-30977)

View related products by pathway.

PTMs for PTPRK Antibody (NBP2-30977)

Learn more about PTMs related to PTPRK Antibody (NBP2-30977).
 

Research Areas for PTPRK Antibody (NBP2-30977)

Find related products by research area.

Blogs on PTPRK

There are no specific blogs for PTPRK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPRK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRK
Uniprot