PTP1B/PTPN1 Antibody - BSA Free

Western Blot: PTP1B/PTPN1 Antibody [NBP1-87191] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PTPN1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: PTP1B/PTPN1 Antibody [NBP1-87191] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.

Immunohistochemistry-Paraffin: PTP1B/PTPN1 Antibody [NBP1-87191] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: PTP1B/PTPN1 Antibody [NBP1-87191] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PTP1B/PTPN1 Antibody [NBP1-87191] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: PTP1B/PTPN1 Antibody [NBP1-87191] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTP1B/PTPN1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PTP1B/PTPN1 Protein (NBP1-87191PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTP1B/PTPN1 Antibody - BSA Free

• EC 3.1.3.48
• protein tyrosine phosphatase 1B
• protein tyrosine phosphatase, non-receptor type 1
• Protein-tyrosine phosphatase 1B
• PTP1B
• PTP-1B
• PTP1Bprotein tyrosine phosphatase, placental
• PTPN1
• tyrosine-protein phosphatase non-receptor type 1

Background

The non-transmembrane protein tyrosine phosphatase, PTP1B, comprises 435 amino acids, of which the C-terminal 114 residues have been implicated in controlling both localization and function of this enzyme. Increased phosphorylation of PTP1B is seen to accompany the transition from G2 to M phase of the cell cycle. Immunofluorescence experiments indicate that PTP-1B is localized predominantly in the endoplasmic reticulum (ER). Subcellular fractionation is consistent with this localization and establishes that PTP-1B is tightly associated with microsomal membranes, with its phosphatase domain oriented towards the cytoplasm. The finding of a tyrosine phosphatase on the ER suggests new possibilities for cellular events controlled by tyrosine phosphorylation (2). It has also been shown that PTP1B is a novel substrate for Akt and that phosphorylation of PTP1B by Akt at Ser(50) may negatively modulate its phosphatase activity creating a positive feedback mechanism for insulin signaling (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPN1