PSTPIP1 Antibody - BSA Free

Western Blot: PSTPIP1 Antibody [NBP2-85554] - WB Suggested Anti-PSTPIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSTPIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSTPIP1 Antibody - BSA Free (NBP2-85554) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of PSTPIP1. Peptide sequence: HIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMES The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSTPIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSTPIP1 Antibody - BSA Free

• CD2BP1CD2-binding protein 1
• CD2BP1L
• CD2BP1S
• H-PIPPEST phosphatase-interacting protein 1
• PAPASCD2 antigen-binding protein 1
• proline-serine-threonine phosphatase interacting protein 1
• proline-serine-threonine phosphatase-interacting protein 1
• PSTPIPCD2 cytoplasmic tail-binding protein

Background

The protein encoded by the PSTPIP1 gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSTPIP1