PRPS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRPS1 Antibody [NBP2-13813] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PRPS1 Antibody [NBP2-13813] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRPS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRPS1 Protein (NBP2-13813PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRPS1 Antibody

  • CMTX5ARTS
  • deafness, X-linked 2, perceptive, congenital
  • DFN2
  • DFNX1KIAA0967
  • dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1)
  • EC 2.7.6.1
  • Phosphoribosyl pyrophosphate synthase I
  • phosphoribosyl pyrophosphate synthetase 1
  • PPRibP
  • PRSI
  • PRS-I
  • ribose-phosphate diphosphokinase 1
  • ribose-phosphate pyrophosphokinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6486
Species: Hu
Applications: WB, Simple Western
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13813
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PRPS1 Antibody (NBP2-13813) (0)

There are no publications for PRPS1 Antibody (NBP2-13813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPS1 Antibody (NBP2-13813) (0)

There are no reviews for PRPS1 Antibody (NBP2-13813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRPS1 Antibody (NBP2-13813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRPS1 Products

Bioinformatics Tool for PRPS1 Antibody (NBP2-13813)

Discover related pathways, diseases and genes to PRPS1 Antibody (NBP2-13813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRPS1 Antibody (NBP2-13813)

Discover more about diseases related to PRPS1 Antibody (NBP2-13813).
 

Pathways for PRPS1 Antibody (NBP2-13813)

View related products by pathway.

Research Areas for PRPS1 Antibody (NBP2-13813)

Find related products by research area.

Blogs on PRPS1

There are no specific blogs for PRPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPS1