NHS Antibody (6D9)

Images

 
Immunocytochemistry/ Immunofluorescence: NHS Antibody (6D9) [H00004810-M05] - Analysis of monoclonal antibody to NHS on HeLa cell. Antibody concentration 10 ug/ml
ELISA: NHS Antibody (6D9) [H00004810-M05] - Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NHS Antibody (6D9) Summary

Immunogen
NHS (NP_938011.1, 1532 a.a. ~ 1629 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSS
Specificity
This product is specific for Human NHS monoclonal antibody (M05), clone 6D9 [Gene ID: 4810].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NHS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:100-1:2000

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHS Antibody (6D9)

  • Congenital cataracts and dental anomalies protein
  • CXN
  • DKFZp781F2016
  • DKFZp781L0254
  • FLJ22511
  • Nance-Horan syndrome (congenital cataracts and dental anomalies)
  • Nance-Horan syndrome protein
  • SCML1

Background

The NHS gene encodes a protein containing four conserved nuclear localization signals. The encoded protein may function during the development of the eyes, teeth, and brain. Mutations in this gene have been shown to cause Nance-Horan syndrome. An alternative

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
AF5827
Species: Hu, Mu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
DY2037
Species: Hu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P

Publications for NHS Antibody (H00004810-M05) (0)

There are no publications for NHS Antibody (H00004810-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHS Antibody (H00004810-M05) (0)

There are no reviews for NHS Antibody (H00004810-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NHS Antibody (H00004810-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHS Products

Array H00004810-M05

Bioinformatics Tool for NHS Antibody (H00004810-M05)

Discover related pathways, diseases and genes to NHS Antibody (H00004810-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHS Antibody (H00004810-M05)

Discover more about diseases related to NHS Antibody (H00004810-M05).
 

Pathways for NHS Antibody (H00004810-M05)

View related products by pathway.

PTMs for NHS Antibody (H00004810-M05)

Learn more about PTMs related to NHS Antibody (H00004810-M05).
 

Research Areas for NHS Antibody (H00004810-M05)

Find related products by research area.

Blogs on NHS

There are no specific blogs for NHS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHS Antibody (6D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NHS
Uniprot