Protein Disulfide Isomerase/P4HB Antibody - BSA Free

Western Blot: Protein Disulfide Isomerase/P4HB Antibody [NBP1-57949] - HepG2 tissue lysate at a concentration of 0.5ug/ml.

Immunohistochemistry-Paraffin: Protein Disulfide Isomerase/P4HB Antibody [NBP1-57949] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Protein Disulfide Isomerase/P4HB Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Protein Disulfide Isomerase/P4HB (procollagen-proline, 2-oxoglutarate 4-dioxygenase, beta polypeptide) The peptide sequence was selected from the N terminal of Protein Disulfide Isomerase/P4HB. Peptide sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV The peptide sequence for this immunogen was taken from within the described region.
• Marker: Fibroblast Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P4HB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Protein Disulfide Isomerase/P4HB Antibody - BSA Free

• Cellular thyroid hormone-binding protein
• collagen prolyl 4-hydroxylase beta
• DSI
• ERBA2L
• GIT
• glutathione-insulin transhydrogenase
• P4HB
• P4Hbeta
• p55
• PDI
• PDIA1
• PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1)
• PDIEC 5.3.4.1
• PHDB
• PO4DB
• PO4HB
• procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide
• PROHB
• PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55)
• Prolyl 4-hydroxylase subunit beta
• prolyl 4-hydroxylase, beta polypeptide
• protein disulfide isomerase family A, member 1
• protein disulfide isomerase/oxidoreductase
• protein disulfide isomerase-associated 1
• protein disulfide-isomerase
• protocollagen hydroxylase
• Thbp
• thyroid hormone-binding protein p55

Background

P4HB, the beta subunit of prolyl 4-hydroxylase, a highly abundant member of the PDI family. P4HB is a multifunctional enzyme, involved in hydroxylation of prolyl residues in preprocollagen, as well as continual rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P4HB
• Uniprot:
  • P07237()