Prostatic Acid Phosphatase/ACPP Antibody

Images

 
Western Blot: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining in human prostate and endometrium tissues using anti-ACPP antibody. Corresponding ACPP RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prostatic Acid Phosphatase/ACPP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
Specificity
Specificity of human Prostatic Acid Phosphatase/ACPP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prostatic Acid Phosphatase/ACPP Protein (NBP2-39012PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prostatic Acid Phosphatase/ACPP Antibody

  • acid phosphatase, prostate
  • ACP3
  • ACP-3
  • ACPP
  • EC 3.1.3.2
  • PAP
  • Prostatic Acid Phosphatase
  • prostatic acid phosphotase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no publications for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no reviews for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Discover related pathways, diseases and genes to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Discover more about diseases related to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).
 

Pathways for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

View related products by pathway.

PTMs for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Learn more about PTMs related to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).
 

Research Areas for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Find related products by research area.

Blogs on Prostatic Acid Phosphatase/ACPP

There are no specific blogs for Prostatic Acid Phosphatase/ACPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prostatic Acid Phosphatase/ACPP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACPP
Uniprot