Prostatic Acid Phosphatase/ACPP Antibody


Western Blot: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prostatic Acid Phosphatase/ACPP Antibody [NBP2-39012] - Staining in human prostate and endometrium tissues using anti-ACPP antibody. Corresponding ACPP RNA-seq data are presented for the more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Prostatic Acid Phosphatase/ACPP Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
Specificity of human Prostatic Acid Phosphatase/ACPP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prostatic Acid Phosphatase/ACPP Protein (NBP2-39012PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Prostatic Acid Phosphatase/ACPP Antibody

  • acid phosphatase, prostate
  • ACP3
  • ACP-3
  • ACPP
  • EC
  • PAP
  • Prostatic Acid Phosphatase
  • prostatic acid phosphotase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC

Publications for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no publications for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no reviews for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Prostatic Acid Phosphatase/ACPP Products

Bioinformatics Tool for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Discover related pathways, diseases and genes to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Discover more about diseases related to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).

Pathways for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

View related products by pathway.

PTMs for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Learn more about PTMs related to Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012).

Research Areas for Prostatic Acid Phosphatase/ACPP Antibody (NBP2-39012)

Find related products by research area.

Blogs on Prostatic Acid Phosphatase/ACPP

There are no specific blogs for Prostatic Acid Phosphatase/ACPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Prostatic Acid Phosphatase/ACPP Antibody and receive a gift card or discount.


Gene Symbol ACPP