Prolactin Antibody (CL6559)

Images

 
Immunohistochemistry-Paraffin: Prolactin Antibody (CL6559) [NBP2-76505] - Staining of human pituitary gland shows strong cytoplasmic positivity in a subset of neuroendocrine cells.
Immunohistochemistry-Paraffin: Prolactin Antibody (CL6559) [NBP2-76505] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clone
CL6559
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Prolactin Antibody (CL6559) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN
Epitope
HKIDNYLKLLKCRII
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PRL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Prolactin Antibody (CL6559)

  • PRL
  • Prolactin

Background

Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
291-G1
Species: Hu
Applications: BA
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
NBP2-46376
Species: Hu
Applications: IHC, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
DSHBG0B
Species: Hu
Applications: ELISA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Prolactin Antibody (NBP2-76505) (0)

There are no publications for Prolactin Antibody (NBP2-76505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prolactin Antibody (NBP2-76505) (0)

There are no reviews for Prolactin Antibody (NBP2-76505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prolactin Antibody (NBP2-76505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prolactin Products

Bioinformatics Tool for Prolactin Antibody (NBP2-76505)

Discover related pathways, diseases and genes to Prolactin Antibody (NBP2-76505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolactin Antibody (NBP2-76505)

Discover more about diseases related to Prolactin Antibody (NBP2-76505).
 

Pathways for Prolactin Antibody (NBP2-76505)

View related products by pathway.

PTMs for Prolactin Antibody (NBP2-76505)

Learn more about PTMs related to Prolactin Antibody (NBP2-76505).
 

Research Areas for Prolactin Antibody (NBP2-76505)

Find related products by research area.

Blogs on Prolactin.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolactin Antibody (CL6559) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRL