Home » Prolactin » Prolactin Antibodies » Prolactin Antibody (CL6559)

Prolactin Antibody (CL6559)

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Prolactin Antibody (CL6559) [NBP2-76505] - Staining of human pituitary gland shows strong cytoplasmic positivity in a subset of neuroendocrine cells.
Immunohistochemistry-Paraffin: Prolactin Antibody (CL6559) [NBP2-76505] - Staining of human pituitary gland shows strong cytoplasmic positivity in a subset of neuroendocrine cells.
Immunohistochemistry-Paraffin: Prolactin Antibody (CL6559) [NBP2-76505] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clone
CL6559
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Prolactin Antibody (CL6559) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN
Epitope
HKIDNYLKLLKCRII
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PRL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Prolactin Antibody (CL6559)

  • PRL
  • Prolactin

Background

Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Thyrotropin
Releasing Hormone Ant
NBP2-94348
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of extracts of various cell lines, using Thyrotropin Releasing Hormone at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of U2OS cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Thyrotropin Releasing Hormone Antibody [NBP2-94348] - Analysis of L929 cells using TRH Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Analysis in control (vector only transfected HEK293T lysate) and GGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunoprecipitation: BRD2 Antibody [NBP1-30475] - Detection of human BRD2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for IP at 6 ug per reaction. BRD2 was also immunoprecipitated by rabbit anti-BRD2 antibody NBP1-30474 and rabbit anti-BRD2 recombinant monoclonal antibody [BL-167-2A2] (NBP2-76410). For blotting immunoprecipitated BRD2, NBP2-76410 was used at 1:1000. Detection: Chemiluminescence with an exposure time time of 3 minutes.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(199 Publications)
Species: Hu
Applications: BA
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: VIP Antibody (1E8) [NBP2-46349] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: IHC, WB
Prolactin R
Antibody (U5)
NB300-561
Immunohistochemistry: Prolactin R Antibody (U5) [NB300-561] - Figure 1 shows immunohistochemical staining of PRL receptor in rat Islets of Langerhans using NB300-561.
Immunocytochemistry/Immunofluorescence: Prolactin R Antibody (U5) [NB300-561] - Prolactin Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Prolactin Receptor at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Prolactin R Antibody (U5) [NB300-561] - Prolactin Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Prolactin Receptor at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(13 Publications)
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GHRH Antibody
NBP3-04850
Western Blot: GHRH Antibody [NBP3-04850] - Western blot analysis of extracts of various cell lines, using GHRH antibody (NBP3-04850) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence: Somatostatin Antibody (7G5) [NBP2-37447] - Paraffin-embedded human adult pancreas tissue. pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
ELISA: Somatostatin Antibody (7G5) [NBP2-37447] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Pit1 Antibody
NBP1-92273
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
(16 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and M1 mouse myeloid leukemia cell line. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for STAT5a at approximately 94 kDa and STAT5b at approximately 92 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5a/b at approximately 91 kDa (as indicated) using 20 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
BaF3 mouse pro-B cell line treated with 10 ng/mL Recombinant Mouse IL‑3 (Catalog # 403-ML) for 1 hour was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. STAT5a/b/DNA complexes were immunoprecipitated using 5 μg Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) or control antibody (Catalog # AB-105-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Rabbit IgG Secondary Antibody (Catalog # BAF008). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The bcl-x promoter was detected by standard PCR.
(14 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: IHC, WB
STAT5b Antibody
[Unconjugated]
AF1584
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, M1 mouse myeloid leukemia cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for STAT5b at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5b at approximately 92 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and STAT5b knockout HeLa cell line (KO). PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for STAT5b at approximately 90 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
SHBG [HRP]
DSHBG0B
(10 Publications)
Species: Hu
Applications: ELISA
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Prolactin Antibody (NBP2-76505) (0)

There are no publications for Prolactin Antibody (NBP2-76505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prolactin Antibody (NBP2-76505) (0)

There are no reviews for Prolactin Antibody (NBP2-76505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prolactin Antibody (NBP2-76505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prolactin Products

Bioinformatics Tool for Prolactin Antibody (NBP2-76505)

Discover related pathways, diseases and genes to Prolactin Antibody (NBP2-76505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolactin Antibody (NBP2-76505)

Discover more about diseases related to Prolactin Antibody (NBP2-76505).
 

Pathways for Prolactin Antibody (NBP2-76505)

View related products by pathway.

PTMs for Prolactin Antibody (NBP2-76505)

Learn more about PTMs related to Prolactin Antibody (NBP2-76505).
 

Research Areas for Prolactin Antibody (NBP2-76505)

Find related products by research area.

Blogs on Prolactin.

Check out the latest blog posts on Prolactin.
Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolactin Antibody (CL6559) and receive a gift card or discount.


Bioinformatics

Gene Symbol PRL