Prohibitin Antibody

Images

 
Western Blot: Prohibitin Antibody [NBP1-87283] - Analysis in human cell lines Caco-2 and HeLa using Anti-PHB antibody. Corresponding PHB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Prohibitin Antibody [NBP1-87283] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria & vesicles.
Immunohistochemistry-Paraffin: Prohibitin Antibody [NBP1-87283] - Staining of human stomach shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.
Western Blot: Prohibitin Antibody [NBP1-87283] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Prohibitin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
Marker
Mitochondria Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Prohibitin Protein (NBP1-87283PEP)
Publications
Read Publications using
NBP1-87283 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prohibitin Antibody

  • PHB
  • PHB1
  • Prohibitin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
NBP1-82609
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
44260002
Species: Hu
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Prohibitin Antibody (NBP1-87283)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Prohibitin Antibody (NBP1-87283) (0)

There are no reviews for Prohibitin Antibody (NBP1-87283). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Prohibitin Antibody (NBP1-87283) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prohibitin Products

Bioinformatics Tool for Prohibitin Antibody (NBP1-87283)

Discover related pathways, diseases and genes to Prohibitin Antibody (NBP1-87283). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prohibitin Antibody (NBP1-87283)

Discover more about diseases related to Prohibitin Antibody (NBP1-87283).
 

Pathways for Prohibitin Antibody (NBP1-87283)

View related products by pathway.

PTMs for Prohibitin Antibody (NBP1-87283)

Learn more about PTMs related to Prohibitin Antibody (NBP1-87283).
 

Research Areas for Prohibitin Antibody (NBP1-87283)

Find related products by research area.

Blogs on Prohibitin

There are no specific blogs for Prohibitin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prohibitin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHB
Entrez