Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ |
Marker | Peroxisome Marker |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ACAA1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB reported in scientific literature (PMID: 24762439). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Theoretical MW | 44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-85786 | Applications | Species |
---|---|---|
da Silva TF, Eira J, Lopes AT et al. Peripheral nervous system plasmalogens regulate Schwann cell differentiation and myelination. J Clin Invest 2014-06-01 [PMID: 24762439] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for ACAA1 Antibody (NBP1-85786)Discover more about diseases related to ACAA1 Antibody (NBP1-85786).
| Pathways for ACAA1 Antibody (NBP1-85786)View related products by pathway.
|
PTMs for ACAA1 Antibody (NBP1-85786)Learn more about PTMs related to ACAA1 Antibody (NBP1-85786).
| Research Areas for ACAA1 Antibody (NBP1-85786)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.