HADHB Antibody

Images

 
Independent Antibodies: Western Blot: HADHB Antibody [NBP1-82609] - Analysis using Anti-HADHB antibody NBP1-82609 (A) shows similar pattern to independent antibody NBP2-38353 (B).
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HADHB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG
Specificity
Specificity of human HADHB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HADHB Protein (NBP1-82609PEP)
Publications
Read Publication using
NBP1-82609 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HADHB Antibody

  • 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
  • 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
  • acetyl-CoA acyltransferase
  • beta subunit
  • beta-ketothiolase
  • EC 2.3.1
  • EC 2.3.1.16
  • ECHB
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
  • hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
  • MGC87480
  • mitochondrial trifunctional enzyme, beta subunit
  • mitochondrial trifunctional protein, beta subunit
  • MTPB
  • TP-beta
  • trifunctional enzyme subunit beta, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02615
Species: Hu, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85502
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-62489
Species: Hu, Mu, Dr
Applications: WB
NB100-53791
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Eq, Ha, Md, Pm, Rb
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, Dual ISH-IHC, GS, KD, KO, PCR
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-92630
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP1-82609
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for HADHB Antibody (NBP1-82609)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for HADHB Antibody (NBP1-82609) (0)

There are no reviews for HADHB Antibody (NBP1-82609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HADHB Antibody (NBP1-82609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HADHB Products

Bioinformatics Tool for HADHB Antibody (NBP1-82609)

Discover related pathways, diseases and genes to HADHB Antibody (NBP1-82609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHB Antibody (NBP1-82609)

Discover more about diseases related to HADHB Antibody (NBP1-82609).
 

Pathways for HADHB Antibody (NBP1-82609)

View related products by pathway.

PTMs for HADHB Antibody (NBP1-82609)

Learn more about PTMs related to HADHB Antibody (NBP1-82609).

Blogs on HADHB

There are no specific blogs for HADHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADHB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHB