HADHB Antibody - BSA Free

Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ and Z) compared with decreasing amounts of total protein extract from WT NIH 3T3 cells. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2162253118303135) licensed under a CC-BY license.

Immunohistochemistry: HADHB Antibody [NBP1-82609] - (B) IHC staining of murine adductor muscle after ischemia induction revealed expression of HADHB, predominantly in the cytoplasm of cells. (D) Microarray analysis of mRNA expression of HADHB mRNA in the adductor muscle of mice at several time points after induction of ischemia (4 mice per time point). (E) Western blot showing HADHB levels in murine adductor muscle tissue on day 0, 1, and 3 after hindlimb ligation. For each time point, samples from right (R) unligated paws and left (L) ligated paws are presented next to each other. Tubulin was used as a loading control. (F) Quantification of the western blot. The HADHB signal was normalized against tubulin. Each bar represents a biological triplicate and technical duplicate. Image collected and cropped by CiteAb from the following publication (//linkinghub.elsevier.com/retrieve/pii/S2162253118303135) licensed under a CC-BY license.

Western Blot: HADHB Antibody [NBP1-82609] - Analysis using Anti-HADHB antibody NBP1-82609 (A) shows similar pattern to independent antibody NBP2-38353 (B).

Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Western Blot: HADHB Antibody [NBP1-82609] - Identification of Proteins Binding Pre-miR-329 & Pre-miR-495(A) Schematic representation of RNA pull-down combined with SILAC mass spectrometry. (B) Proteins showing increased or decreased binding to pre-miR-329, pre-miR-495, or both. (C) Western blot validation of HADHB & CIRBP binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation. DHX9 is used as a binding control. (D & E) Quantification of the western blot, showing HADHB (D) & CIRBP (E) binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation (relative to input). *p < 0.05, n = 3. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ & Z) compared with decreasing amounts of total protein extract from WT NIH 3T3 cells. (B) Alignment of the region surrounding the CRISPR-Cas9 target sequence from genomic DNA of clones AQ & Z. (C & D) Levels of mature (C) or precursor (D) miR-329 & miR-495 as well as control miR-423 in WT & HADHB KO cell lines quantified by qRT-PCR & normalized to miR-16. For pre-miRs, n = 3; for mature miRs, n = 9. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: HADHB Antibody [NBP1-82609] - Expression of CIRBP & HADHB In Vivo(A & B) Immunohistochemical staining of murine adductor muscle after ischemia induction revealed expression of both CIRBP (A) & HADHB (B) in these tissues, predominantly in the cytoplasm of cells. (C & D) Microarray analysis of mRNA expression of CIRBP (C) & HADHB (D) mRNA in the adductor muscle of mice at several time points after induction of ischemia (4 mice per time point). (E) Western blot showing HADHB levels in murine adductor muscle tissue on day 0, day 1, & day 3 after hindlimb ligation. For each time point, samples from right (R) unligated paws & left (L) ligated paws are presented next to each other. Tubulin was used as a loading control. (F) Quantification of the western blot. The HADHB signal was normalized against tubulin, & the relative change between ligated & unligated is presented. Each bar represents a biological triplicate & technical duplicate. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HADHB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HADHB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HADHB Protein (NBP1-82609PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HADHB Antibody - BSA Free

• 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
• 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
• acetyl-CoA acyltransferase
• beta subunit
• beta-ketothiolase
• EC 2.3.1
• EC 2.3.1.16
• ECHB
• hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
• hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
• hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
• MGC87480
• mitochondrial trifunctional enzyme, beta subunit
• mitochondrial trifunctional protein, beta subunit
• MTPB
• TP-beta
• trifunctional enzyme subunit beta, mitochondrial

Background

HADHB encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HADHB Antibody (NBP1-82609)(2)

Publications using NBP1-82609

• Downie Ruiz Velasco A, Welten SMJ, Goossens EAC et al. Posttranscriptional Regulation of 14q32 MicroRNAs by the CIRBP and HADHB during Vascular Regeneration after Ischemia Mol Ther Nucleic Acids 2019-03-01 [PMID: 30665182] (IHC-P, Mouse)
  
  Details:
  Novus HADHB antibody used in IHC analysis of paraffin embedded tissue from mous adductor muscles
• Maurya S. K, Herrera J. L, et al. Sarcolipin Signaling Promotes Mitochondrial Biogenesis and Oxidative Metabolism in Skeletal Muscle. Cell Rep 2018-09-11 [PMID: 30208317] (WB, Mouse)

Bioinformatics

• Gene Symbol: HADHB