Genetic Strategies: Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ and Z) compared ...read more
Immunohistochemistry: HADHB Antibody [NBP1-82609] - (B) IHC staining of murine adductor muscle after ischemia induction revealed expression of HADHB, predominantly in the cytoplasm of cells. (D) Microarray analysis of ...read more
Independent Antibodies: Western Blot: HADHB Antibody [NBP1-82609] - Analysis using Anti-HADHB antibody NBP1-82609 (A) shows similar pattern to independent antibody NBP2-38353 (B).
Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Western Blot: HADHB Antibody [NBP1-82609] - Identification of Proteins Binding Pre-miR-329 & Pre-miR-495(A) Schematic representation of RNA pull-down combined with SILAC mass spectrometry. (B) Proteins showing increased ...read more
Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ & Z) compared with decreasing amounts of ...read more
Western Blot: HADHB Antibody [NBP1-82609] - Expression of CIRBP & HADHB In Vivo(A & B) Immunohistochemical staining of murine adductor muscle after ischemia induction revealed expression of both CIRBP (A) & HADHB (B) ...read more
Novus Biologicals Knockout (KO) Validated Rabbit HADHB Antibody - BSA Free (NBP1-82609) is a polyclonal antibody validated for use in IHC and WB. Anti-HADHB Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
MGC87480
mitochondrial trifunctional enzyme, beta subunit
mitochondrial trifunctional protein, beta subunit
MTPB
TP-beta
trifunctional enzyme subunit beta, mitochondrial
Background
HADHB encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HADHB Antibody - BSA Free and receive a gift card or discount.