Profilin 2 Antibody (6G3)

Images

 
Western Blot: Profilin 2 Antibody (6G3) [H00005217-M05] - Analysis of PFN2 expression in HeLa (Cat # L013V1).
Sandwich ELISA: Profilin 2 Antibody (6G3) [H00005217-M05] - Detection limit for recombinant GST tagged PFN2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Profilin 2 Antibody (6G3) Summary

Immunogen
PFN2 (NP_002619, 41 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
Specificity
PFN2 - profilin 2 (6G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PFN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Profilin 2 Antibody (6G3)

  • D3S1319E
  • PFL
  • profilin 2
  • Profilin II
  • profilin-2

Background

The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00375189-B01P
Species: Hu
Applications: WB, ELISA
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005217-M05
Species: Hu
Applications: WB, ELISA

Publications for Profilin 2 Antibody (H00005217-M05) (0)

There are no publications for Profilin 2 Antibody (H00005217-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Profilin 2 Antibody (H00005217-M05) (0)

There are no reviews for Profilin 2 Antibody (H00005217-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Profilin 2 Antibody (H00005217-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Profilin 2 Products

Bioinformatics Tool for Profilin 2 Antibody (H00005217-M05)

Discover related pathways, diseases and genes to Profilin 2 Antibody (H00005217-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Profilin 2 Antibody (H00005217-M05)

Discover more about diseases related to Profilin 2 Antibody (H00005217-M05).
 

Pathways for Profilin 2 Antibody (H00005217-M05)

View related products by pathway.

PTMs for Profilin 2 Antibody (H00005217-M05)

Learn more about PTMs related to Profilin 2 Antibody (H00005217-M05).

Blogs on Profilin 2.

Profiling the Profilin 1 Antibody
Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Profilin 2 Antibody (6G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PFN2
Entrez
Uniprot