PRMT8 Antibody - BSA Free

Western Blot: PRMT8 Antibody [NBP1-55401] - Lanes: 1 : 30ug HeLa lysate , 2: 30ug HFF lysate , 3: 30ug U2OS lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: PRMT8.

Western Blot: PRMT8 Antibody [NBP1-55401] - Transfected 293T cell lysate, concentration 2.5 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

PRMT8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PRMT8(protein arginine methyltransferase 8) The peptide sequence was selected from the C terminal of PRMT8 (NP_872294). Peptide sequence YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRMT8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for PRMT8 Antibody - BSA Free

• EC 2.1.1
• EC 2.1.1.-
• EC 2.1.1.77
• Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4
• HMT1 hnRNP methyltransferase-like 3 (S. cerevisiae)
• HMT1 hnRNP methyltransferase-like 3
• HMT1 hnRNP methyltransferase-like 4 (S. cerevisiae)
• HMT1 hnRNP methyltransferase-like 4
• HRMT1L3
• HRMT1L4
• PRMT8
• protein arginine methyltransferase 8
• protein arginine N-methyltransferase 4
• protein arginine N-methyltransferase 8

Background

PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PRMT8 Antibody (NBP1-55401)(1)

Publication using NBP1-55401

• Li J, Yao H, Zhao F et al. Pycard deficiency inhibits microRNA maturation and prevents neointima formation by promoting chaperone-mediated autophagic degradation of AGO2/argonaute 2 in adipose tissue Autophagy 2023-11-14 [PMID: 37963060] (IP, Mouse)
  
  Details:
  IHC-P Dilution 1:300; IP Dilution: 1?µg of antibody was added to 500?µg of cell lysate and incubated overnight at 4°C, and then incubated with protein A agarose beads for 4?h

FAQs for PRMT8 Antibody (NBP1-55401). (Showing 1 - 1 of 1 FAQ).

1. We have a customer who is looking for an antibody that detect endogenous PRMT8 and found Cat.No.NBP1-55401 and NBP1-81702 (anti-PRMT8). The customer would like some further information on how you verified that the antibody indeed detects PRMT8,and only PRMT8. Kat.Nr. NBP1-55401 is generated against the C-term of PRMT8, and when looking at the allignment of PRMT8 and PRMT1, the C-terminus shows high homology (please see attached). Do you have any further information what this antibody detects or has the antibody never been tested in anything else than the transfected cell lysate? (PRMT1) For Kat.Nr. NBP1-81702, do you have any data showing endogenous protein in Western Blot? Will Cat.No. NBP1-81702 be guaranteed to detect endogenous protein in Western Blot, since it does detect endogenous protein in brain tissue sections in IHC?
   • Our PRMT8 antibody with catalogue number NBP1-55401 was raised to an immunogen sequence derived from the C-terminus of human PRMT8 which, as you rightly point out, shares 78% sequence homology with PRMT1. Unfortunately we have not tested the cross-reactivity of this antibody with PRMT1 and so I am unable to confirm whether or not it recognises PRMT1. The only testing data we currently have is that which is shown on our website, the Western blot image using lysate from transfected 293T cells. NBP1-81702 is covered by our guarantee for detection of PRMT8 in human and mouse samples by Western blotting and IHC with paraffin-embedded samples. Our testing data was again derived using an over-expression lysate and we do not have an image showing detection of the endogenous protein by Western blotting. However, as you know, we stand proudly behind our guarantee that our antibodies will work in the species and applications listed on our website and on our product datasheets.

Bioinformatics

• Gene Symbol: PRMT8
• Entrez:
  • 56341(Human)
• Uniprot:
  • Q9NR22(Human)