TAF8 Antibody


Western Blot: TAF8 Antibody [NBP2-38188] - Analysis in control (vector only transfected HEK293T lysate) and TAF8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human lymph node shows weak nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TAF8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF8 Protein (NBP2-38188PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TAF8 Antibody

  • 45/50kDa
  • FLJ32821
  • II
  • Protein taube nuss
  • RNA polymerase II, 43 kD
  • TAF(II)43,43
  • TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, A
  • taube nuss homolog (mouse)
  • TBP-associated factor 43 kDa
  • TBP-associated factor 8
  • transcription initiation factor TFIID subunit 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, NULL, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TAF8 Antibody (NBP2-38188) (0)

There are no publications for TAF8 Antibody (NBP2-38188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF8 Antibody (NBP2-38188) (0)

There are no reviews for TAF8 Antibody (NBP2-38188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF8 Antibody (NBP2-38188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TAF8 Products

Bioinformatics Tool for TAF8 Antibody (NBP2-38188)

Discover related pathways, diseases and genes to TAF8 Antibody (NBP2-38188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF8 Antibody (NBP2-38188)

Discover more about diseases related to TAF8 Antibody (NBP2-38188).

Pathways for TAF8 Antibody (NBP2-38188)

View related products by pathway.

Blogs on TAF8

There are no specific blogs for TAF8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TAF8 Antibody and receive a gift card or discount.


Gene Symbol TAF8