TAF8 Antibody

Western Blot: TAF8 Antibody [NBP2-38188] - Analysis in control (vector only transfected HEK293T lysate) and TAF8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TAF8 Antibody [NBP2-38188] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human lymph node shows weak nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TAF8 Antibody [NBP2-38188] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TAF8 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
• Predicted Species: Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TAF8 Protein (NBP2-38188PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAF8 Antibody

• 45/50kDa
• FLJ32821
• II
• Protein taube nuss
• RNA polymerase II, 43 kD
• TAF(II)43,43
• TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, A
• taube nuss homolog (mouse)
• TBP-associated factor 43 kDa
• TBP-associated factor 8
• transcription initiation factor TFIID subunit 8

Background

TAF8 encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF8
• Uniprot:
  • Q7Z7C8(Human)