PRG2 Antibody

Images

 
Western Blot: PRG2 Antibody [H00005553-B01P] - Analysis of PRG2 expression in transfected 293T cell line by PRG2 polyclonal antibody. Lane 1: PRG2 transfected lysate(24.53 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRG2 Antibody Summary

Immunogen
PRG2 (AAH05929.1, 1 a.a. - 222 a.a.) full-length human protein. MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTQPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PRG2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRG2 Antibody

  • BMPGeosinophil major basic protein
  • bone marrow proteoglycan
  • bone-marrow proteoglycan
  • MBP1
  • MBPeosinophil granule major basic protein
  • MGC14537
  • natural killer cell activator
  • proteoglycan 2 preproprotein
  • Proteoglycan 2
  • proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRG2 Antibody (H00005553-B01P) (0)

There are no publications for PRG2 Antibody (H00005553-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRG2 Antibody (H00005553-B01P) (0)

There are no reviews for PRG2 Antibody (H00005553-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRG2 Antibody (H00005553-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRG2 Products

Bioinformatics Tool for PRG2 Antibody (H00005553-B01P)

Discover related pathways, diseases and genes to PRG2 Antibody (H00005553-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRG2 Antibody (H00005553-B01P)

Discover more about diseases related to PRG2 Antibody (H00005553-B01P).
 

Pathways for PRG2 Antibody (H00005553-B01P)

View related products by pathway.

PTMs for PRG2 Antibody (H00005553-B01P)

Learn more about PTMs related to PRG2 Antibody (H00005553-B01P).
 

Research Areas for PRG2 Antibody (H00005553-B01P)

Find related products by research area.

Blogs on PRG2

There are no specific blogs for PRG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRG2
Uniprot