PREB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PREB Antibody [NBP1-87056] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PREB Antibody [NBP1-87056] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Analysis in human cell line RPMI-8226.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PREB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PREB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF reported in scientific literature (PMID: 27101143). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PREB Protein (NBP1-87056PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PREB Antibody - BSA Free

• MGC3467
• PREB
• prolactin regulatory binding-element protein
• prolactin regulatory element binding
• prolactin regulatory element-binding protein
• SEC12
• SEC12Mammalian guanine nucleotide exchange factor mSec12

Background

Prolactin (PRL) expression in the pituitary is limited to specific cells. Pit-1 is a pituitary specific transcription factor that plays an important role in PRL expression, both in mature organism and during development. The PRL promoter contains numerous Pit-1 binding sites and these sites have been implicated in both basal level and kinase-mediated gene expression. The most proximal of these binding sites, termed 1P, has been shown to direct a response to numerous signals, such as cAMP and various G-proteins. A novel protein, termed PREB (prolactin regulatory element binding protein), has been recently identified that regulates PRL gene expression through the 1P site, though it contains no discernable DNA-binding motif. Recent studies suggest that PREB is encoded by a single-copy gene in both mice and humans and exhibits nuclear accumulation in pituitary cells. Evidence suggests that PREB is a novel transcription factor that assists in PRL expression whether alone, or in concert with Pit-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PREB Antibody (NBP1-87056)(3)

Publications using NBP1-87056

• Nalbach K, Schifferer M, Bhattacharya D et al. Spatial proteomics reveals secretory pathway disturbances caused by neuropathy-associated TECPR2 Nature communications 2023-02-16 [PMID: 36797266] (ICC/IF, WB, Human)
• Gallo R, Rai A, Pelkmas L. DYRK3-Controlled Phase Separation Organizes the Early Secretory Pathway Cells 2019-09-01 [PMID: 31470564]
• Ackema KB, Prescianotto-Baschong C, Hench J et al. Sar1, a Novel Regulator of ER-Mitochondrial Contact Sites. PLoS ONE. 2016-04-22 [PMID: 27101143] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: PREB