PRAT4A/TNRC5 Antibody - BSA Free

Western Blot: PRAT4A/TNRC5 Antibody [NBP2-88089] - WB Suggested Anti-CNPY3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: ACHN cell lysateCNPY3 is supported by BioGPS gene expression data to be expressed in ACHN

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PRAT4A/TNRC5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRAT4A/TNRC5. Peptide sequence: MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNPY3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PRAT4A/TNRC5 Antibody - BSA Free

• CAG4A
• canopy 3 homolog (zebrafish)
• CNPY3
• CTG4A
• ERDA5
• ERDA5CTG repeat protein 4a
• Expanded repeat-domain protein CAG/CTG 5
• PRAT4A
• PRAT4ACAG repeat containing
• Protein associated with TLR4
• protein associated with Toll-like receptor 4A
• protein canopy homolog 3
• TNRC5
• TNRC5expanded repeat domain, CAG/CTG 5
• trinucleotide repeat containing 5
• Trinucleotide repeat-containing gene 5 protein

Background

PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNPY3