PPAR gamma/NR1C3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PPAR gamma/NR1C3 Antibody [NBP2-56194] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPAR gamma/NR1C3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVE
Specificity
Specificity of human PPAR gamma/NR1C3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPARG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PPAR gamma/NR1C3 Antibody

  • CIMT1
  • NR1C3
  • NR1C3GLM1
  • Nuclear receptor subfamily 1 group C member 3
  • peroxisome proliferator-activated receptor gamma 1
  • peroxisome proliferator-activated receptor gamma
  • PPAR gamma
  • PPARG
  • PPARG1peroxisome proliferative activated receptor, gamma
  • PPARG2PPARgamma
  • PPAR-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Po, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56194
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PPAR gamma/NR1C3 Antibody (NBP2-56194) (0)

There are no publications for PPAR gamma/NR1C3 Antibody (NBP2-56194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAR gamma/NR1C3 Antibody (NBP2-56194) (0)

There are no reviews for PPAR gamma/NR1C3 Antibody (NBP2-56194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPAR gamma/NR1C3 Antibody (NBP2-56194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PPAR gamma/NR1C3 Products

Bioinformatics Tool for PPAR gamma/NR1C3 Antibody (NBP2-56194)

Discover related pathways, diseases and genes to PPAR gamma/NR1C3 Antibody (NBP2-56194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAR gamma/NR1C3 Antibody (NBP2-56194)

Discover more about diseases related to PPAR gamma/NR1C3 Antibody (NBP2-56194).
 

Pathways for PPAR gamma/NR1C3 Antibody (NBP2-56194)

View related products by pathway.

PTMs for PPAR gamma/NR1C3 Antibody (NBP2-56194)

Learn more about PTMs related to PPAR gamma/NR1C3 Antibody (NBP2-56194).
 

Research Areas for PPAR gamma/NR1C3 Antibody (NBP2-56194)

Find related products by research area.

Blogs on PPAR gamma/NR1C3.

PPAR gamma - An important target in human metabolism
Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells by interacting with members of the nuclear hormone receptor superfamily known as peroxisome proliferator activated receptors (PPARs). There are f...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAR gamma/NR1C3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARG