PPAR gamma/NR1C3 Antibody (9P1J6)

Western Blot: PPAR gamma/NR1C3 Antibody (9P1J6) [NBP3-15853] - Western blot analysis of extracts of various cell lines, using PPAR gamma/NR1C3 antibody (NBP3-15853) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Rt
• Applications: WB
• Clone: 9P1J6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPAR gamma/NR1C3 Antibody (9P1J6) Summary

• Description: Novus Biologicals Rabbit PPAR gamma/NR1C3 Antibody (9P1J6) (NBP3-15853) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPAR gamma/NR1C3 (P37231). LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PPARG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPAR gamma/NR1C3 Antibody (9P1J6)

• CIMT1
• NR1C3
• NR1C3GLM1
• Nuclear receptor subfamily 1 group C member 3
• peroxisome proliferator-activated receptor gamma 1
• peroxisome proliferator-activated receptor gamma
• PPAR gamma
• PPARG
• PPARG1peroxisome proliferative activated receptor, gamma
• PPARG2PPARgamma
• PPAR-gamma

Background

PPAR gamma(PPARG), which encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPARG