PORCN Antibody - BSA Free

Western Blot: PORCN Antibody [NBP3-35234] - Western blot analysis of various lysates using PORCN Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PORCN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PORCN Antibody - BSA Free (NBP3-35234) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).
  
  Sequence:
  PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PORCN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PORCN Antibody - BSA Free

• 2410004O13Rik
• DHOF
• EC 2.3.1.-
• EC 2.3.1.250
• FODH
• MG61
• MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine
• por
• PORC
• PORCMGC29687
• PORCN
• porcupine homolog (Drosophila)
• PPN
• Protein MG61

Background

The PORCN gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PORCN