Home » PORCN » PORCN Antibodies » PORCN Antibody

PORCN Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml
Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PORCN Antibody [NBP1-59677] - SampleType: Mouse Uterus - Dilution 1 in 300. - secondary antibody dilution 1 in 1000.
Western Blot: PORCN Antibody [NBP1-59677] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: PORCN Antibody [NBP1-59677] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PORCN Antibody Summary

Immunogen
Synthetic peptides corresponding to PORCN(porcupine homolog (Drosophila)) The peptide sequence was selected from the N terminal of PORCN (NP_073736). Peptide sequence ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PORCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:300
  • Western Blot 1.0 ug/ml
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59677 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PORCN Antibody

  • 2410004O13Rik
  • DHOF
  • EC 2.3.1.-
  • EC 2.3.1.250
  • FODH
  • MG61
  • MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine
  • por
  • PORC
  • PORCMGC29687
  • PORCN
  • porcupine homolog (Drosophila)
  • PPN
  • Protein MG61

Background

PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.This gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
LRP2 Antibody
(CD7D5) - Azide and B ...
NB110-96417
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - U2OS cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.1% Saponin. The cells were incubated with anti-LRP2 (CD7D5) at 20 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: LRP2 Antibody (CD7D5) [NB110-96417] - Representative immunofluorescence stainings of control (Tead4m-z+) and Tead4 maternal/zygotic mutant (Tead4m-z-) embryos for Krt8 and Krt18 (16 cell stage embryos) and Lrp2 and Dab2 (32 to 64 cell stage embryos; Lrp2 and Dab2 were not detected in earlier stage embryos). n indicates total number of embryos analyzed. Scale bar: 25 um. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/22906), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Analysis of a FFPE tissue section of mouse kidney using 1:200 dilution of LRP2 [CD7D5] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MCF2L Antibody
(1D11)
H00023263-M01
Sandwich ELISA: MCF2L Antibody (1D11) [H00023263-M01] - Detection limit for recombinant GST tagged MCF2L is approximately 0.03ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: MCF2L Antibody (1D11) [H00023263-M01] - Analysis of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
EEF1A2 Antibody
NBP2-33280
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33280] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
VDAC1 Antibody
NB100-695
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Alkaline extraction of mitochondria-associated proteins, showing alkaline extract of the mitochondrial pellet and the alkaline-resistant mitochondrial pellet from cells expressing each BNIP3 phosphomutant. All blots are representative of at least 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Subcellular localization of BNIP3 phosphomutants, showing Western blot of cytosolic and mitochondrial fractions. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - Lane 1: rat heart whole cell lysate. Lane 2: none. Load: 35 ug per lane. Primary antibody: VDAC/Porin antibody at 1:1,200 for overnight at 4C. Secondary antibody: IRDye800 (TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~32 kDa corresponding to VDAC/Porin (arrowhead).
(6 Publications)
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in 13 year old testis. Immunoexpression in Leydig cell. Image from a verified customer review.
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in macaque Leydig cells. Image from a verified customer review.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Hela cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(4 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Choline
Acetyltransferase/ChA
NBP1-30052
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brainstem showing specific labeling using the anti-ChAT antibody. Image courtesy of Dr. Robert Sloviter, University of Arizona.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Immunostaining of anterior horn of lumbar spinal cord for Choline Acetyltransferase/ChAT (in green) and p62 (in red) at 130 days. Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Representative images of lumbar spinal cord sections at 130 days immunostained with Choline Acetyltransferase/ChAT. Scale bar, 200 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
(18 Publications)
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Fucosyltransferase
3/FUT3 Antibody (2-25 ...
NB500-526
Immunohistochemistry: Blood Group Lewis b Antibody (2-25LE) [NB500-526] - Immunohistochemistry staining of human colon adenocarcinoma (paraffin sections) using anti-blood group Lewis b (clone 2-25LE).
Immunohistochemistry: Blood Group Lewis b Antibody (2-25LE) [NB500-526] - Staining of human small intestine (paraffin sections) using anti-blood group Lewis b (clone 2-25LE).
(3 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
SSB Antibody
(OTI2C8)
NBP1-48002
Western Blot: SSB Antibody (OTI2C8) [NBP1-48002] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SSB (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SSB.
Immunohistochemistry-Paraffin: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-SSB mouse monoclonal antibody.
Immunohistochemistry-Paraffin: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-SSB mouse monoclonal antibody.
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
CYP21A2 Antibody
NBP2-13893
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.
Species: Hu
Applications: IHC, IHC-P, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(58 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86615
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86615] - Staining of human tonsil shows low expression as expected.
Western Blot: CRAT Antibody [NBP1-86615] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Cytochrome P450
3A4 Antibody (3H8) - ...
NBP2-37502
ELISA: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against human CYP3A4 (AA: 243-430) recombinant protein. (Expected MW is 47.5 kDa)
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PORCN Antibody
NBP1-59677
PORCN Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PORCN Antibody (NBP1-59677)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-59677 Applications Species
Mohamed R, Kennedy C, Willmore WG Responses of porcupine and Wntless proteins to oxidative, hypoxic and endoplasmic reticulum stresses Cellular signalling May 17 2021 [PMID: 34015469] (WB) WB
Clinch M The Role of Hypoxia on PORCN and WLS Expression in Human Embryonic Kidney (HEK293T) and Human Colon Cancer (HCT-116T) Cells Carleton University Apr 5 2022 (WB, Human) WB Human

Reviews for PORCN Antibody (NBP1-59677) (0)

There are no reviews for PORCN Antibody (NBP1-59677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PORCN Antibody (NBP1-59677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PORCN Products

Bioinformatics Tool for PORCN Antibody (NBP1-59677)

Discover related pathways, diseases and genes to PORCN Antibody (NBP1-59677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PORCN Antibody (NBP1-59677)

Discover more about diseases related to PORCN Antibody (NBP1-59677).
 

Pathways for PORCN Antibody (NBP1-59677)

View related products by pathway.

PTMs for PORCN Antibody (NBP1-59677)

Learn more about PTMs related to PORCN Antibody (NBP1-59677).

Blogs on PORCN

There are no specific blogs for PORCN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PORCN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PORCN
Entrez
Uniprot