POMT1 Antibody

Immunocytochemistry/Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Discontinued

POMT1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POMT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for POMT1 Antibody

• Dolichyl-phosphate-mannose--protein mannosyltransferase 1
• EC 2.4.1
• EC 2.4.1.109
• FLJ37239
• LGMD2K
• MDDGA1
• MDDGB1
• MDDGC1
• protein O-mannosyl-transferase 1
• protein-O-mannosyltransferase 1
• RT

Background

O-mannosylation is an important protein modification in eukaryotes that is initiated by an evolutionarily conserved family of protein O-mannosyltransferases. POMT1 shares sequence similarity with protein O-mannosyltransferases of S. cerevisiae. In yeast, these enzymes are located in the endoplasmic reticulum (ER) and are required for cell integrity and cell wall rigidity. POMT1 also shows similarity to the Drosophila 'rotated abdomen' (rt) gene, which when mutated causes defects in myogenesis and muscle structure.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POMT1