New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

POMT1 Antibody


Immunocytochemistry/ Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

POMT1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTS
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POMT1 Recombinant Protein Antigen (NBP2-57200PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for POMT1 Antibody

  • Dolichyl-phosphate-mannose--protein mannosyltransferase 1
  • EC 2.4.1
  • EC
  • FLJ37239
  • LGMD2K
  • MDDGA1
  • MDDGB1
  • MDDGC1
  • protein O-mannosyl-transferase 1
  • protein-O-mannosyltransferase 1
  • RT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF

Publications for POMT1 Antibody (NBP2-57200) (0)

There are no publications for POMT1 Antibody (NBP2-57200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMT1 Antibody (NBP2-57200) (0)

There are no reviews for POMT1 Antibody (NBP2-57200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POMT1 Antibody (NBP2-57200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional POMT1 Products

Array NBP2-57200

Bioinformatics Tool for POMT1 Antibody (NBP2-57200)

Discover related pathways, diseases and genes to POMT1 Antibody (NBP2-57200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMT1 Antibody (NBP2-57200)

Discover more about diseases related to POMT1 Antibody (NBP2-57200).

Pathways for POMT1 Antibody (NBP2-57200)

View related products by pathway.

PTMs for POMT1 Antibody (NBP2-57200)

Learn more about PTMs related to POMT1 Antibody (NBP2-57200).

Research Areas for POMT1 Antibody (NBP2-57200)

Find related products by research area.

Blogs on POMT1

There are no specific blogs for POMT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POMT1 Antibody and receive a gift card or discount.


Gene Symbol POMT1