POMT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POMT1 Antibody [NBP2-57200] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POMT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTS
Specificity
Specificity of human POMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POMT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POMT1 Recombinant Protein Antigen (NBP2-57200PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POMT1 Antibody

  • Dolichyl-phosphate-mannose--protein mannosyltransferase 1
  • EC 2.4.1
  • EC 2.4.1.109
  • FLJ37239
  • LGMD2K
  • MDDGA1
  • MDDGB1
  • MDDGC1
  • protein O-mannosyl-transferase 1
  • protein-O-mannosyltransferase 1
  • RT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
H00005555-P01
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for POMT1 Antibody (NBP2-57200) (0)

There are no publications for POMT1 Antibody (NBP2-57200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMT1 Antibody (NBP2-57200) (0)

There are no reviews for POMT1 Antibody (NBP2-57200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POMT1 Antibody (NBP2-57200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for POMT1 Antibody (NBP2-57200)

Discover related pathways, diseases and genes to POMT1 Antibody (NBP2-57200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMT1 Antibody (NBP2-57200)

Discover more about diseases related to POMT1 Antibody (NBP2-57200).
 

Pathways for POMT1 Antibody (NBP2-57200)

View related products by pathway.

PTMs for POMT1 Antibody (NBP2-57200)

Learn more about PTMs related to POMT1 Antibody (NBP2-57200).

Blogs on POMT1

There are no specific blogs for POMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POMT1