POMC Antibody

Images

 
Immunohistochemistry-Paraffin: POMC Antibody [NBP2-55008] - Staining of human pituitary gland shows strong cytoplasmic positivity in a subset of cells in anterior lobe.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POMC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Specificity
Specificity of human POMC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POMC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
POMC Recombinant Protein Antigen (NBP2-55008PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POMC Antibody

  • ACTH
  • adrenocorticotropic hormone
  • adrenocorticotropin
  • alpha-melanocyte-stimulating hormone
  • alpha-MSH
  • beta-endorphin
  • beta-LPH
  • beta-melanocyte-stimulating hormone
  • beta-MSH
  • CLIP
  • corticotropin-like intermediary peptide
  • corticotropin-lipotropin
  • gamma-LPH
  • gamma-MSH
  • lipotropin beta
  • lipotropin gamma
  • LPH
  • melanotropin alpha
  • melanotropin beta
  • melanotropin gamma
  • met-enkephalin
  • MSH
  • NPP
  • POC
  • POMC
  • pro-ACTH-endorphin
  • proopiomelanocortin preproprotein
  • proopiomelanocortin
  • pro-opiomelanocortin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
9134-TN
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for POMC Antibody (NBP2-55008) (0)

There are no publications for POMC Antibody (NBP2-55008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMC Antibody (NBP2-55008) (0)

There are no reviews for POMC Antibody (NBP2-55008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for POMC Antibody (NBP2-55008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for POMC Antibody (NBP2-55008)

Discover related pathways, diseases and genes to POMC Antibody (NBP2-55008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMC Antibody (NBP2-55008)

Discover more about diseases related to POMC Antibody (NBP2-55008).
 

Pathways for POMC Antibody (NBP2-55008)

View related products by pathway.

PTMs for POMC Antibody (NBP2-55008)

Learn more about PTMs related to POMC Antibody (NBP2-55008).
 

Research Areas for POMC Antibody (NBP2-55008)

Find related products by research area.

Blogs on POMC

There are no specific blogs for POMC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POMC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POMC