Podocalyxin Like Antibody

Images

 
Immunohistochemistry-Paraffin: Podocalyxin Antibody [NBP2-13784] Staining of human kidney shows moderate membranous positivity in renal glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Podocalyxin Like Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKAT TLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADT TTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTST
Marker
Podocytes /Apical Marker, Endothelial Cell Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PODXL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Podocalyxin Like Recombinant Protein Antigen (NBP2-13784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Podocalyxin Like Antibody

  • GCTM
  • Gp200MGC138240
  • PCLP
  • PCLP1
  • PCLP-1
  • PCLPGCTM-2 antigen
  • PCpodocalyxin
  • POD XL
  • Podocalyxin
  • Podocalyxin-like protein 1
  • podocalyxin-like
  • PODXL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF3159
Species: Mu
Applications: WB, IHC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-13784
Species: Hu
Applications: IHC, IHC-P

Publications for Podocalyxin Like Antibody (NBP2-13784) (0)

There are no publications for Podocalyxin Like Antibody (NBP2-13784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Podocalyxin Like Antibody (NBP2-13784) (0)

There are no reviews for Podocalyxin Like Antibody (NBP2-13784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Podocalyxin Like Antibody (NBP2-13784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Podocalyxin Like Products

Bioinformatics Tool for Podocalyxin Like Antibody (NBP2-13784)

Discover related pathways, diseases and genes to Podocalyxin Like Antibody (NBP2-13784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Podocalyxin Like Antibody (NBP2-13784)

Discover more about diseases related to Podocalyxin Like Antibody (NBP2-13784).
 

Pathways for Podocalyxin Like Antibody (NBP2-13784)

View related products by pathway.

PTMs for Podocalyxin Like Antibody (NBP2-13784)

Learn more about PTMs related to Podocalyxin Like Antibody (NBP2-13784).
 

Research Areas for Podocalyxin Like Antibody (NBP2-13784)

Find related products by research area.

Blogs on Podocalyxin Like

There are no specific blogs for Podocalyxin Like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Podocalyxin Like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PODXL
Entrez