PMM1/Phosphomannomutase 1 Antibody

Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PMM1/Phosphomannomutase 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PMM1/Phosphomannomutase 1 Protein (NBP1-87055PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMM1/Phosphomannomutase 1 Antibody

• brain glucose-1,6-bisphosphatase
• EC 5.4.2.8
• phosphomannomutase 1
• PMM 1
• PMMH22
• PMMH-22
• Sec53

Background

Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (GPI) anchored proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PMM1