Orthogonal Strategies: Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Analysis in human placenta and skeletal muscle tissues using NBP1-84725 antibody. Corresponding FBLN1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human endometrium shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human skin shows strong positivity in extracellular matrix.
Orthogonal Strategies: Analysis in human cell lines HeLa and SK-MEL-30 using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Novus Biologicals Rabbit Fibulin 1 Antibody - BSA Free (NBP1-84725) is a polyclonal antibody validated for use in IHC and WB. Anti-Fibulin 1 Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Reactivity reported in scientific literature (PMID: 24743550).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Fibulin 1 Antibody - BSA Free
FBLN
FBLN1
FIBL1
FIBL-1
Fibulin 1
fibulin-1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Yan X, Guo Y, Chen J et al. The molecular interaction of ADAMTS-1 and fibulin-1 and its potential contribution to breast cancer biology JCMT 2019-05-05 (WB, Human)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.