Fibulin 1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Analysis in human placenta and skeletal muscle tissues using NBP1-84725 antibody. Corresponding FBLN1 RNA-seq data are ...read more
Orthogonal Strategies: Western Blot: Fibulin 1 Antibody [NBP1-84725] - Analysis in human cell lines HeLa and SK-MEL-30 using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human endometrium shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human skin shows strong positivity in extracellular matrix.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Fibulin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
Specificity
Specificity of human Fibulin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC,HIER pH6 retrieval is recommended.
Control Peptide
Fibulin 1 Protein (NBP1-84725PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-84725 in the following applications:

Publications
Read Publications using
NBP1-84725 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibulin 1 Antibody

  • FBLN
  • FBLN1
  • FIBL1
  • FIBL-1
  • Fibulin 1
  • fibulin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88115
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22408
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-691
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, IHC, IHC-P, IP
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-76929
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00030008-B01P
Species: Hu
Applications: WB, Flow
AF3385
Species: Hu
Applications: WB, IHC
NB100-81909
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2327
Species: Hu
Applications: WB, IP
AF5800
Species: Mu, Rt
Applications: WB, IHC
NBP1-84725
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Fibulin 1 Antibody (NBP1-84725)(5)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for Fibulin 1 Antibody (NBP1-84725) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-84725:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Fibulin 1 NBP1-84725
Enlarge
3
reviewed by:
Anonymous
IHC-P Human 04/11/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedhuman skin
SpeciesHuman
LotA71667

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibulin 1 Antibody (NBP1-84725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fibulin 1 Products

Bioinformatics Tool for Fibulin 1 Antibody (NBP1-84725)

Discover related pathways, diseases and genes to Fibulin 1 Antibody (NBP1-84725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibulin 1 Antibody (NBP1-84725)

Discover more about diseases related to Fibulin 1 Antibody (NBP1-84725).
 

Pathways for Fibulin 1 Antibody (NBP1-84725)

View related products by pathway.

PTMs for Fibulin 1 Antibody (NBP1-84725)

Learn more about PTMs related to Fibulin 1 Antibody (NBP1-84725).
 

Research Areas for Fibulin 1 Antibody (NBP1-84725)

Find related products by research area.

Blogs on Fibulin 1

There are no specific blogs for Fibulin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
04/11/2019
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol FBLN1