ZBED4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ZBED4 Antibody - BSA Free (NBP2-13531) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZBED4 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for ZBED4 Antibody - BSA Free
Background
ZBED4 is a gene that codes for a protein expressed in the testis, kidney and spinal cord, with a length of 1171 amino acids and a weight of approximately 130 kDa. Current studies are being done on diseases and disorders linked to this gene including bipolar affective disorder, corpus callosum, and retinitis. ZBED4 has also been shown to have interactions with CBX1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Pm, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for ZBED4 Antibody (NBP2-13531) (0)
There are no publications for ZBED4 Antibody (NBP2-13531).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZBED4 Antibody (NBP2-13531) (0)
There are no reviews for ZBED4 Antibody (NBP2-13531).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZBED4 Antibody (NBP2-13531) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZBED4 Products
Blogs on ZBED4