PMM2/Phosphomannomutase 2 Antibody


Western Blot: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PMM2/Phosphomannomutase 2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQS
Specificity of human PMM2/Phosphomannomutase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PMM2/Phosphomannomutase 2 Antibody

  • CDG1
  • CDG1a
  • CDGS
  • EC
  • phosphomannomutase 2
  • PMM 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P

Publications for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753) (0)

There are no publications for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753) (0)

There are no reviews for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PMM2/Phosphomannomutase 2 Products

Bioinformatics Tool for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753)

Discover related pathways, diseases and genes to PMM2/Phosphomannomutase 2 Antibody (NBP2-57753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753)

Discover more about diseases related to PMM2/Phosphomannomutase 2 Antibody (NBP2-57753).

Pathways for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753)

View related products by pathway.

PTMs for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753)

Learn more about PTMs related to PMM2/Phosphomannomutase 2 Antibody (NBP2-57753).

Research Areas for PMM2/Phosphomannomutase 2 Antibody (NBP2-57753)

Find related products by research area.

Blogs on PMM2/Phosphomannomutase 2

There are no specific blogs for PMM2/Phosphomannomutase 2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PMM2/Phosphomannomutase 2 Antibody and receive a gift card or discount.


Gene Symbol PMM2
COVID-19 update