PML Protein Antibody - BSA Free

Immunohistochemistry-Paraffin: PML Protein Antibody [NBP1-87783] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

ChIP-Exo-Seq composite graph for Anti-PML (NBP1-87783) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PML Protein Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PML Protein Antibody - BSA Free (NBP1-87783) is a polyclonal antibody validated for use in IHC and WB. Anti-PML Protein Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PML
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.. Use in Western blot reported in scientific literature (PMID 28095508).
• Control Peptide:

  PML Protein Protein (NBP1-87783PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 24194542)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PML Protein Antibody - BSA Free

• MYLPP8675
• Promyelocytic leukemia protein
• promyelocytic leukemia
• RING finger protein 71
• RNF71probable transcription factor PML
• TRIM19promyelocytic leukemia, inducer of
• tripartite motif protein TRIM19
• Tripartite motif-containing protein 19

Background

PML Protein is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PML Protein Antibody (NBP1-87783)(3)

Publications using NBP1-87783

• Niu C, Livingston CM, Li L et al. The Smc5/6 Complex Restricts HBV when Localized to ND10 without Inducing an Innate Immune Response and Is Counteracted by the HBV X Protein Shortly after Infection PLoS ONE 2017-01-17 [PMID: 28095508] (WB, Human)
• Stepp WH, Meyers JM, McBride AA. Sp100 Provides Intrinsic Immunity against Human Papillomavirus Infection. mBio 2013-11-05 [PMID: 24194542]
• Campagna M, Herranz D, Garcia MA et al. SIRT1 stabilizes PML promoting its sumoylation. Cell Death Differ 2011-01-01 [PMID: 20577263]

Bioinformatics

• Gene Symbol: PML