PLK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PLK1 Antibody [NBP2-49014] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLK1 Antibody - BSA Free (NBP2-49014) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PLK1 Recombinant Protein Antigen (NBP2-49014PEP)

Reactivity Notes

Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLK1 Antibody - BSA Free

• cell cycle regulated protein kinase
• EC 2.7.11
• EC 2.7.11.21
• PLK
• PLK1
• PLK-1
• polo (Drosophia)-like kinase
• polo like kinase
• polo-like kinase 1polo-like kinase (Drosophila)
• Serine/threonine-protein kinase 13
• serine/threonine-protein kinase PLK1
• STPK13

Background

Considerable evidence indicates that a Polo-Like Kinase (PLK) plays an important role in cell cycle regulation. PLK is also required for bipolar spindle formation, activation of the anaphase-promoting complex/cyclosome, and cytokinesis. Recent work led to the identification of a PLKK that is thought to be responsible for activation of PLK. Recent work (Erikson, et al., 2004) has shown that PLKK is in turn activated by phosphorylation at three sites (Ser482, Ser486 and Ser490). Thus activation of PLK is thought to involve a kinase cascade involving the phosphorylation of Ser482,486,490 in PLKK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLK1