PLK2 Antibody - Azide and BSA Free

Western Blot: PLK2 Antibody [NBP3-04961] -Analysis of extracts of various cell lines, using PLK2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Western Blot: PLK2 Antibody [NBP3-04961] -analysis of extracts of various cell lines, using PLK2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.

ICC/IF-NBP3-04961-PLK2 Antibody- Analysis of NIH/3T3 cells using PLK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ICC/IF-NBP3-04961-PLK2 Antibody-Analysis of PC-12 cells using PLK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLK2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PLK2 Antibody - Azide and BSA Free (NBP3-04961) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2). KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PLK2 Antibody - Azide and BSA Free

• EC 2.7.11
• EC 2.7.11.21
• hPlk2
• hSNK
• PLK2
• PLK-2
• Polo-like kinase 2
• polo-like kinase 2EC 2.7.11.21
• serine/threonine-protein kinase PLK2
• Serine/threonine-protein kinase SNK
• Serum-inducible kinase
• SNK
• SNKpolo-like kinase 2 (Drosophila)

Background

Serum-inducible kinase is a member of the 'polo' family of serine/threonine protein kinases that have a role in normal cell division.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLK2