PLK2 Antibody - Azide and BSA Free

Images

 
Western Blot: PLK2 Antibody [NBP3-04961] -Analysis of extracts of various cell lines, using PLK2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug ...read more
Western Blot: PLK2 Antibody [NBP3-04961] -analysis of extracts of various cell lines, using PLK2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug ...read more
ICC/IF-NBP3-04961-PLK2 Antibody- Analysis of NIH/3T3 cells using PLK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ICC/IF-NBP3-04961-PLK2 Antibody-Analysis of PC-12 cells using PLK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PLK2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2). KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLK2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for PLK2 Antibody - Azide and BSA Free

  • EC 2.7.11
  • EC 2.7.11.21
  • hPlk2
  • hSNK
  • PLK2
  • PLK-2
  • Polo-like kinase 2
  • polo-like kinase 2EC 2.7.11.21
  • serine/threonine-protein kinase PLK2
  • Serine/threonine-protein kinase SNK
  • Serum-inducible kinase
  • SNK
  • SNKpolo-like kinase 2 (Drosophila)

Background

Serum-inducible kinase is a member of the 'polo' family of serine/threonine protein kinases that have a role in normal cell division.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLK2 Antibody (NBP3-04961) (0)

There are no publications for PLK2 Antibody (NBP3-04961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK2 Antibody (NBP3-04961) (0)

There are no reviews for PLK2 Antibody (NBP3-04961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLK2 Antibody (NBP3-04961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLK2 Products

Research Areas for PLK2 Antibody (NBP3-04961)

Find related products by research area.

Blogs on PLK2

There are no specific blogs for PLK2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLK2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PLK2