Plexin A3 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit Plexin A3 Antibody - Azide and BSA Free (NBP2-93992) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 950-1150 of human PLXNA3 (NP_059984.3). GTRLTISGSSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLCKAPGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVKPGSHVVLKGKN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLXNA3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
207 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Plexin A3 Antibody - Azide and BSA Free
Background
Plexin A3, also known by its gene name PLXNA3, has 1,871 amino acids and is approximately 208kDa. Plexin A3 is a cell surface, transmembrane protein that is a member of the Plexin family. Plexin A3 is thought to play a role in the development of neural tissue and epithelial tissue, as well as function in axon guidance. Current research on Plexin A3 is being performed in relation to several diseases and disorders including Rett syndrome, neuronitis and ovarian cancer. Plexin A3 has also been shown to have interactions with SMN1, SMN2, MAPK8IP2, CBFA2T3 and CSNK2B in pathways such as the axon guidance pathway and the Semaphorin signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Plexin A3 Antibody (NBP2-93992) (0)
There are no publications for Plexin A3 Antibody (NBP2-93992).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Plexin A3 Antibody (NBP2-93992) (0)
There are no reviews for Plexin A3 Antibody (NBP2-93992).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Plexin A3 Antibody (NBP2-93992) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Plexin A3 Products
Research Areas for Plexin A3 Antibody (NBP2-93992)
Find related products by research area.
|
Blogs on Plexin A3