Plexin A3 Antibody

Images

 
Western Blot: Plexin A3 Antibody [NBP2-56699] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: Plexin A3 Antibody [NBP2-56699] - Staining of human cell line MCF7 shows localization to nucleus, cell junctions & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plexin A3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Specificity
Specificity of human Plexin A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLXNA3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP)

Reactivity Notes

Mouse 84%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Plexin A3 Antibody

  • HSSEXGENE
  • Plexin A3
  • plexin-4
  • plexin-A3
  • Plxn3
  • PLXN4
  • PLXNA3
  • Semaphorin receptor SEX
  • Sex chromosome X transmembrane protein of HGF receptor family 3
  • SEX
  • SEXPLEXIN-A3,6.3
  • XAP-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-85128
Species: Hu, Mu
Applications: IHC, IHC-P
AF2215
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, Block, CyTOF-ready
NBP1-91480
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF3749
Species: Hu
Applications: WB, IHC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-82527
Species: Hu, Mu
Applications: IHC, IHC-P
AF5375
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-61663
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF1146
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-38268
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-56699
Species: Hu
Applications: WB, ICC/IF

Publications for Plexin A3 Antibody (NBP2-56699) (0)

There are no publications for Plexin A3 Antibody (NBP2-56699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin A3 Antibody (NBP2-56699) (0)

There are no reviews for Plexin A3 Antibody (NBP2-56699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plexin A3 Antibody (NBP2-56699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Plexin A3 Products

Bioinformatics Tool for Plexin A3 Antibody (NBP2-56699)

Discover related pathways, diseases and genes to Plexin A3 Antibody (NBP2-56699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plexin A3 Antibody (NBP2-56699)

Discover more about diseases related to Plexin A3 Antibody (NBP2-56699).
 

Pathways for Plexin A3 Antibody (NBP2-56699)

View related products by pathway.

PTMs for Plexin A3 Antibody (NBP2-56699)

Learn more about PTMs related to Plexin A3 Antibody (NBP2-56699).
 

Research Areas for Plexin A3 Antibody (NBP2-56699)

Find related products by research area.

Blogs on Plexin A3

There are no specific blogs for Plexin A3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plexin A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLXNA3