PJA2/Praja2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PJA2/Praja2 Antibody [NBP1-83006] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: PJA2/Praja2 Antibody [NBP1-83006] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PJA2/Praja2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAEAYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PJA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PJA2/Praja2 Protein (NBP1-83006PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PJA2/Praja2 Antibody

  • E3 ubiquitin-protein ligase Praja-2
  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0438praja2
  • Neurodap1
  • praja ring finger 2
  • Praja2
  • RING finger protein 131praja 2, RING-H2 motif containing
  • RNF131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46270
Species: Hu
Applications: WB, IHC
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB

Publications for PJA2/Praja2 Antibody (NBP1-83006) (0)

There are no publications for PJA2/Praja2 Antibody (NBP1-83006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PJA2/Praja2 Antibody (NBP1-83006) (0)

There are no reviews for PJA2/Praja2 Antibody (NBP1-83006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PJA2/Praja2 Antibody (NBP1-83006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PJA2/Praja2 Products

Bioinformatics Tool for PJA2/Praja2 Antibody (NBP1-83006)

Discover related pathways, diseases and genes to PJA2/Praja2 Antibody (NBP1-83006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PJA2/Praja2 Antibody (NBP1-83006)

Discover more about diseases related to PJA2/Praja2 Antibody (NBP1-83006).
 

Pathways for PJA2/Praja2 Antibody (NBP1-83006)

View related products by pathway.

PTMs for PJA2/Praja2 Antibody (NBP1-83006)

Learn more about PTMs related to PJA2/Praja2 Antibody (NBP1-83006).
 

Research Areas for PJA2/Praja2 Antibody (NBP1-83006)

Find related products by research area.

Blogs on PJA2/Praja2

There are no specific blogs for PJA2/Praja2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PJA2/Praja2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PJA2