PITX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PITX2 Antibody [NBP2-55572] - Staining of human cell line U-2 OS shows localization to nucleus.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITX2 Antibody - BSA Free (NBP2-55572) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
• Predicted Species: Mouse (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PITX2 Recombinant Protein Antigen (NBP2-55572PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PITX2 Antibody - BSA Free

• all1-responsive gene 1
• ALL1-responsive protein ARP1
• ARP1MGC20144
• Brx1
• Homeobox protein PITX2
• IDG2
• IGDS
• IGDS2
• IHG2
• IRID2
• Otlx2
• paired-like homeodomain 2
• Paired-like homeodomain transcription factor 2MGC111022
• pituitary homeo box 2
• pituitary homeobox 2
• PITX2
• PTX2
• RGS
• RGSRIEG1Brx1
• rieg bicoid-related homeobox transcription factor 1
• RIEG bicoid-related homeobox transcription factor
• RIEG
• RIEG1
• RP1
• RS
• Solurshin

Background

PITX2 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITX2